CAZyme Information: MGYG000002171_00284

Basic Information

• Species: Phocaeicola sp002493165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002493165
• CAZyme ID: MGYG000002171_00284
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925	MGYG000002171_3|CGC1	104627.85	6.6618

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002171	3793747	MAG	Denmark	Europe

• Gene Location: Start: 45478; End: 48255 Strand: +

Full Sequence      

MKINTLLFLSLLTVSCSQPENRINLTGKWQFTTDSTNWSGSILLPGSMASNGLGKDIDIS
TPWTGSINDESYFKNERYAKYRNSDNIKIPFWLQPVKYYKGAAWYRKEVNIPTDWKQQDI
SLFLERCHWETRLWVDDKEIGMQNTLGTPHQYDLSDVLTPGKHTLTLRIDNRIKDIDPGE
NSHSISDHTQGNWNGVIGDMCLQVRPQVNIAHTDIYPDISAKNIRVKTCLKNRKKTKVTA
ILTLKANGKSIQQEVVLLPGENKTETILPLGDNICLWDEFNPNLYTLKASLTNQETTVTD
THTEQFGMRDFRVINRHITINGRPVFLRGTLDCAIFPKTGYPPTDQASWEKIFTACRNHG
MNHIRFHSWCPPEAAFCAADKMGMYLEIECSSWANSSTTIGDGKPLDAFILKESEAIVRT
FGNHPSFCMMMYGNEPAGAGSNNYLAEFTSYWKKQDNRRIYSTAGGWPNLPVSDFLSDPS
PRIQGWGQGLNSIINAQTPRTDYDWSEYINRFTQPIVSHEIGQWCVYPNFKEMKKYTGVM
RPTNFEIFQESLQENGMEALADSFLLASGKLQVLCYKADIEAALRTKDFGGFQLLGLYDF
PGQGTALVGVLNTFWEEKGYISPEEYSRFCNATVPLARLPKLIFTNNETLKASVEVAHYG
DSPLKNATTGWTLRDVAGNILQSGEWNAKEIPVGNNFALGEIVAPLTTVTTPQRLVLEVS
VNNRKNDWNIWVYPTAQQAIPNENKICMTDRLDAITLNTLEKGATVLLSLKKGSLSKELG
GDIQIGFSSIFWNTAWTAKQAPHTLGILCNPAHPALSEFPTEYHSDYQWWDAMSHSGAIE
FCELSPKLHPIVRVIDDWFTNRPLALLFEAKVGKGKILVSGIDFWQDMDKRPEARQLLYS
LKKYMSSPAFHPDTELKKEQIQQLL

Enzyme Prediction     

No EC number prediction in MGYG000002171_00284.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	18	478	2.2e-72	0.5053191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	1.35e-19	17	329	7	296	beta-D-glucuronidase; Provisional
COG3250	LacZ	4.02e-18	19	508	9	470	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	1.19e-12	208	309	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	4.14e-11	24	460	43	471	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	5.79e-09	25	206	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKA51553.1	0.0	1	925	1	925
AUI46175.1	0.0	1	925	1	925
QCQ36726.1	0.0	1	925	1	925
QUU02488.1	0.0	1	925	1	925
QRP90536.1	0.0	1	925	1	925

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	1.78e-20	19	465	35	467	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.78e-20	19	465	36	468	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3GM8_A	2.91e-14	101	439	66	400	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5UJ6_A	1.21e-13	98	447	73	430	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	1.22e-13	98	447	81	438	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	9.77e-20	19	465	36	468	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P24131	8.99e-18	24	465	48	486	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2
Q6LL68	3.07e-15	22	483	46	501	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
O52847	5.30e-15	57	465	93	508	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q9K9C6	1.56e-14	29	510	68	530	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000024	1.000030	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002171_00284.