CAZyme Information: MGYG000002171_00999

Basic Information

• Species: Phocaeicola sp002493165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002493165
• CAZyme ID: MGYG000002171_00999
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
890	MGYG000002171_17|CGC1	101903.99	6.4595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002171	3793747	MAG	Denmark	Europe

• Gene Location: Start: 31806; End: 34478 Strand: +

Full Sequence      

MKNIISVFGLALLCSSPAYAQYKMELDKVATPQLNYIKMGHPGAKGQEIRINNLYWEEAG
KPKFPVMGEFHYNRMDERYWRESLMKMKASGVDIVSTYNLWVLHEEFEGRQDWSGRNNLR
KFVELCKEVGLKVHLRPGPYCNAEIRNGGFPDWIEFNKNLKTRTNDPLYLEYVKYWYQSL
FNQVKGLLYKDGGPIVAIQLENEYVTEGMVVPHLTALKEIAVEAGFDLPVYSMTHWMMSD
YPKGEIIPYAGYYLETPWISFGDKENPTTDQEFFSYNRVSDNIGNDFIKTSAKVESLDAS
ANDSPYFTCEMGLGAPNYYMRRAVVEEEMAGENINLRLGCGVNLMGYYMYVGQTNPIGEQ
YTTARATARVSNDYQAPIREFGQLGVVMKESKKLNYFMNDFGSELVSKRAFLPLANRDRK
NLQWAVRTDGKSGYVFCSNILHKHPRKEYRNVQFNLELDGEKVCLPRKKTTIKDRSYFFW
PFNMDLKGIVLNYATAQPICHLDENGTRHYFFFEDDGIPAEFRFKAENIAEVQTGKGQVK
KSKDAWFVDGLQAGKDCQIRVTGKDGARICITLLTEKESDYIWKGEVNGKKFVGLSESFL
FFDKQEAFLASENPTQTFELFTGGKFVTQTYQSPAIRREAKAVAVAPMNEAQCIRPAKGQ
WVKRTFDARNLAAIERAYLRMQAAPETKAFINGKEITTTDYQGYRYADVTKVCTDEMNEI
SFQTAGTSKDVTAEVEVMLANGTRWLWSTDALWRCEDGRTPIEVQVANAKPSAYDEREHL
AVFQVALPTDMCPEKATRIYINATGDVANAYVGQDLIHDVFINGDEWVIGLNRYTRQIEG
HPTLTLRIDGLKSADINMYLEKDLIRRTDCVQPVMRSIRMEQEYVSLLKL

Enzyme Prediction     

No EC number prediction in MGYG000002171_00999.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	60	394	8.9e-79	0.9739413680781759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	5.40e-54	60	385	6	305	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.55e-26	60	382	41	325	beta-galactosidase; Provisional
COG1874	GanA	5.27e-16	60	204	12	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.06e-06	72	204	2	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ48325.1	0.0	1	884	1	879
QCQ34970.1	0.0	1	884	1	879
QCQ52773.1	0.0	1	884	1	879
CBW24573.1	0.0	1	884	1	879
AKA53703.1	0.0	1	884	1	879

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3THC_A	5.34e-31	48	384	10	320	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	6.11e-31	48	384	34	344	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	1.43e-30	48	384	34	344	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
7KDV_A	3.38e-30	60	204	29	173	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
6EON_A	3.49e-29	60	226	39	205	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58D55	1.68e-31	60	204	44	188	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q60HF6	4.69e-31	48	384	33	343	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
Q5R7P4	8.06e-31	48	384	33	343	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q9TRY9	1.35e-30	60	204	46	190	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
O19015	3.19e-30	60	204	46	190	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000904	0.970571	0.027691	0.000303	0.000269	0.000234

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002171_00999.