CAZyme Information: MGYG000002171_01001

Basic Information

• Species: Phocaeicola sp002493165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002493165
• CAZyme ID: MGYG000002171_01001
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
886	MGYG000002171_17|CGC1	100445.33	6.4626

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002171	3793747	MAG	Denmark	Europe

• Gene Location: Start: 38085; End: 40745 Strand: +

Full Sequence      

MKHRLLVCTALCMATGLAQAQYKMDLSDVTYPKIEYLKMGNVGPVGQEIRINNLYLDKGG
IPQLPVMGEFHYARMNPEFWKDALLKAKASGVNIVSTYCLWALHEESEGELSWKGHLDLH
RFITLCKEIGLKVHLRFGPYCNAEIVNGGLPMWLVNNKQVKKRSNDPLYLAYVRRWYEAV
YRQVEGLFHKDGGPIMGLQLENEYVTRGQIIPHLTTLKRMAQEIGFDVPLYSMTHWMDSE
YPKGEIVPYAGFYIEAPWTTSGKQEMPTSNFEFFTYNRLSDNIGTDIIKIEGEVQSLSGE
NNDSPFFTCEVGVGSTTFYPRRAIIPEEMAGETINLRLGCGANLMGYYMYVGGTNPVGQL
RTFESSGPRVSYDYQAPVRESGTPGNVMPETKKYNYFMNDFGTALAPTVAYLPNSNNDRD
NLQWAIRSKDDAGYLFCSNILYRHERQDFKRVQFTLKLKNETLRIPSKKVTVKGGTYFLW
PFNQHMGEILLKYATVQPICSLNEGKNQTFFFFEDDQIGGEFLLQGDNIKEVTVNRAVCQ
RKKNGYFIDQLQAGKDCVITITKNDGTKVRFVVLTEEQSDMLWKGKTKNREFVALTSSSL
IYDDQHITLIDDAPQTSIDLYDNGTFQTRNFKGDTRRLNANLRALRPMEHSRFIAPAEGS
SVTRTFQLQRFAEVQKAFVRMSAPQGTAFSLNGQTVQMQDLVDYQRADVTKLLRKGEANA
LTLTGMDAQNAAVAEVEILMTNGERILWNTDATWTSAQGKVPAVVKEGTLPKAFAPEEHL
AVYELNAPAPVRGEEETRMYIRYKGDVANAYINGQLVADNFYDGADWIVSLSRQKSTIDA
NPMVIRIDGLKSADAPIYFEKHIDPSLCVQPELNEVEVKQEYRFTF

Enzyme Prediction     

No EC number prediction in MGYG000002171_01001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	60	393	1.1e-79	0.9706840390879479

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	5.78e-55	53	395	1	309	Glycosyl hydrolases family 35.
PLN03059	PLN03059	3.67e-31	66	384	47	327	beta-galactosidase; Provisional
COG1874	GanA	1.38e-13	54	204	8	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	4.65e-06	76	204	3	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ34970.1	0.0	16	884	15	881
QCQ48325.1	0.0	16	884	15	881
CBW24573.1	0.0	2	884	3	881
AKA53703.1	0.0	2	884	3	881
QCQ52773.1	0.0	16	884	15	881

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4E8C_A	1.97e-31	48	384	5	315	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
3THC_A	2.25e-31	58	382	20	318	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	2.58e-31	58	382	44	342	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
7KDV_A	3.41e-31	58	394	27	331	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3WF3_A	6.05e-31	58	382	44	342	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q93Z24	3.03e-33	68	395	82	397	Beta-galactosidase 17 OS=Arabidopsis thaliana OX=3702 GN=BGAL17 PE=2 SV=1
Q58D55	5.37e-33	58	382	42	340	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q0DGD7	4.53e-32	43	386	28	354	Beta-galactosidase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0539400 PE=2 SV=1
Q60HF6	8.44e-32	58	382	43	341	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
Q9TRY9	5.70e-31	58	382	44	342	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000499	0.998169	0.000668	0.000233	0.000213	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002171_01001.