CAZyme Information: MGYG000002171_02241

Basic Information

• Species: Phocaeicola sp002493165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002493165
• CAZyme ID: MGYG000002171_02241
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000002171_59|CGC1	43207.21	6.9806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002171	3793747	MAG	Denmark	Europe

• Gene Location: Start: 17619; End: 18737 Strand: +

Full Sequence      

MNYINRVWGTALAVLFSVSVFARIPFTKVETKNMMRKVADWQIAHPNTGHEHDDVSWTHA
VLYAGMVDWAELSEKEDNYDFYYQWLLRIGNRNHYQLGQWMYHADFIAVAQVYIDLYKKY
GKERMMWHTLARTDWVINHPAKGNLELDYGRIETLDRWSWCDALFMAPPVYAKLYTMTGD
KKYIDFLNREYKATYDFLFDKEENLFYRDSRYFNKKEANGKKVFWGRGNGWVLGGLSEIL
QALPEKDKNRRFYEELFVTLSTRVAELQSKDGYWHASLLDPGSYPSPETSATGFIVYALA
YGINEGLLDKDKFTPVVVKGWQAMLDAVSAEGKLGYVQPIGADPRKVTRDMTEVYGVGAF
LLAGNQIYKMAQ

Enzyme Prediction     

No EC number prediction in MGYG000002171_02241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	51	368	1.4e-83	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.15e-98	35	370	2	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	6.30e-51	17	363	2	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59360.1	3.33e-202	22	370	20	368
QUT89583.1	3.33e-202	22	370	20	368
QDO67620.1	3.91e-197	5	370	2	370
QIU93494.1	1.24e-193	4	372	3	372
QDH53356.1	9.42e-193	13	372	10	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	3.35e-75	26	370	24	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	7.00e-60	27	363	29	367	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.89e-51	57	372	39	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	1.26e-11	160	367	141	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.17e-11	160	367	131	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	1.13e-74	17	372	20	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	2.24e-74	26	370	31	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	3.80e-72	17	367	41	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	6.90e-11	160	367	141	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.023541	0.974941	0.000507	0.000334	0.000311	0.000327

TMHMM  Annotations     

start	end
7	26