CAZyme Information: MGYG000002171_02871

Basic Information

• Species: Phocaeicola sp002493165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002493165
• CAZyme ID: MGYG000002171_02871
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451		51742.75	7.4904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002171	3793747	MAG	Denmark	Europe

• Gene Location: Start: 8148; End: 9503 Strand: +

Full Sequence      

MYMKNNRLSLTFLGLLIALSPLRAQEIAKQETPEQKDKRMEWFSQAKLGIFIHWGIYAVK
GVSESWSFFNNYLPYDEYMNQAGGFTASKYDPKAWVDLIKESGAQYTVITTKHHDGVALW
DTKVGDLSTVKSTPAKRDLIAPFVKEVRKQGLHLGFYYSLLDWSHPDYPNKTRTEVRYKD
DPARWAKFNKFNFGQLAELNKTWKPDLYWFDGDWEQSAEAWNSKGIVDLLRSDNKNVIIN
SRIQGYGDYATPEQGVPVVRPEDKYWELCMTMNDSWGYQHTDSNYKSPYILLRTFVDCLS
NGGNLLLDIGPKEDGTIPEEQVAILKEFGRWTKKHKEAVYDTRAGIPAEHFQGYTTLNKA
GDILYLYLPYKPNGVVEVKGLVNKVNRVWVVGNGAMLSYKVYNKNYWSDVPGNLYIDVPE
QVQDSQITVLAVLLDGPVKLYRGVGRVIESN

Enzyme Prediction     

No EC number prediction in MGYG000002171_02871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	28	341	1.7e-101	0.9132947976878613

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	9.31e-138	30	381	8	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.56e-125	30	337	7	333	Alpha-L-fucosidase.
COG3669	AfuC	2.58e-42	53	344	1	324	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam14871	GHL6	0.005	91	168	1	76	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII64408.1	0.0	3	451	1	449
ABR41654.1	0.0	3	451	1	449
QUT57144.1	0.0	3	451	1	449
QQY40065.1	0.0	3	451	1	449
QQY40682.1	0.0	3	451	1	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	4.12e-81	36	435	27	444	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
2WVS_A	5.88e-56	28	416	2	434	Crystalstructure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_B Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_C Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_D Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482]
2WVT_A	8.22e-56	28	416	2	434	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVT_B Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVU_A Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_B Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_C Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_D Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482]
2XIB_A	1.03e-55	28	416	1	433	CrystalStructure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_B Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_C Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_D Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XII_A Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With An Extended 9- Fluorenone Iminosugar Inhibitor [Bacteroides thetaiotaomicron],2XII_B Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With An Extended 9- Fluorenone Iminosugar Inhibitor [Bacteroides thetaiotaomicron]
4PCS_A	1.05e-55	34	416	13	430	Crystalstructure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_B Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_C Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_D Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_A Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_B Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_C Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_D Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99LJ1	2.32e-51	42	379	38	397	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
Q99KR8	1.51e-49	32	342	31	364	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
Q60HF8	3.37e-49	10	379	18	413	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1
C3YWU0	8.63e-49	13	343	1	356	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
P04066	1.70e-48	8	420	17	446	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.040636	0.955420	0.002110	0.000773	0.000492	0.000528

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002171_02871.