CAZyme Information: MGYG000002171_03097

Basic Information

• Species: Phocaeicola sp002493165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002493165
• CAZyme ID: MGYG000002171_03097
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789		87631.94	5.5891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002171	3793747	MAG	Denmark	Europe

• Gene Location: Start: 472; End: 2841 Strand: -

Full Sequence      

MKNQIALLGLLALCTHSQMSAASPQKSIYHKGWIDFNKNGVMDIYENPKAPLEARVQDLL
SQMTLDEKTCQMATLYGSGRILKDALPQESWKNEIWKDGIGNIDEEHNGLGKFRSEYAFP
YTKHVDTKHTIQRWFIEETRLGIPVDFTNEGIRGLCHDRATYFPAQCGQGATWNKELIAR
IAEVEALEADALGYTNIYSPILDISQDPRWGRCVETYGEDPYLVGQLGKQMVTTLQKHNL
VATPKHFAVYSIPVGGRDGQTRTDPHVAPREMRTLYLEPFRVAFQDAGALGVMSSYNDYD
GEPISGSYHFLTEILRQEWGFKGYVVSDSEAVEFVAGKHKVADTYEDGIAQCVNAGLNVR
TNFTAPDEFIIPLRKAIADGKISFDTVDKRVAEILRVKFWLGLFDHPYRGDGKLAEKIVH
SKEHQAVALDAARQSLVLLKNEKEMLPLSKSIRKVAVIGPNAEEKKQLICRYGPANAPIK
TVFQGIKEMLPDAEVVYRKGCDIVDPHFPESEILDFPKTEEESRLMDEAVAAAQNAEVAI
MVLGGNELTVREDRSRTSLELPGRQEELLKAVMGTGTPVVLVLLDGRAATINYAAATVPA
ILHAWFPGEFCGQVVAEALFGDYNPGGRLAVTFPKSVGQIPFAFPFKPGSDVPASTSVYG
ALYPFGYGLSYTSFVYSDLQITPKEQGVQGEVNISCKVKNAGKVKGDEVVQLYLRDEVSS
VTTYTKVLRGFERISLEPGEEKIVRFKLRPQDLGLWDKNMNFCVEPGSFKVMVGASSADI
RLEGNFEVI

Enzyme Prediction     

No EC number prediction in MGYG000002171_03097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	137	359	1.3e-62	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	43	787	22	763	beta-glucosidase BglX.
PLN03080	PLN03080	2.36e-93	12	750	23	744	Probable beta-xylosidase; Provisional
COG1472	BglX	1.67e-76	130	496	47	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.00e-64	436	671	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.38e-53	64	397	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR73791.1	0.0	2	788	3	786
QJR65195.1	0.0	2	788	3	786
QJR69458.1	0.0	2	788	3	786
AND18153.1	0.0	2	788	3	786
QUT85452.1	0.0	2	788	3	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	4.31e-130	4	781	2	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	1.94e-129	45	788	7	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5XXL_A	9.28e-129	49	781	5	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.44e-128	47	781	2	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
7EAP_A	1.49e-128	45	788	7	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	1.49e-128	43	789	22	765	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	4.46e-127	43	789	22	765	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	9.13e-125	140	777	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	6.32e-113	45	781	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.80e-95	52	780	35	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000249	0.999133	0.000164	0.000156	0.000140	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002171_03097.