CAZyme Information: MGYG000002176_00812

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01
• CAZyme ID: MGYG000002176_00812
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	MGYG000002176_21|CGC1	51163.51	7.2178

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002176	2675847	MAG	Denmark	Europe

• Gene Location: Start: 30295; End: 31686 Strand: +

Full Sequence      

MSGGLYRVTRGGSHNTPEQYLRSANRMAMIPSDRHSMTGFRIVEAPYPTGWRIDESHHSG
VDNQRYHWTATSSNKPIFEEPKVYVIPPTHGTTPFMRHNHQPAITWCNNGDLLAIWFSAD
EENGRDMVVLSSRLHPGAKQWTPAELFFKVPDRNMTGSSLLNDGKGTLYHFNGVEAAGDW
QNLALTMRTSRDNGVTWTRPRIIEPEHTMRHQVIQGPIILRDGTMVQLCDAGPGSEDGTS
IHISHDGGNTWADPWDGAPLPQFTEGGTGTTIAGIHAGIVQLRDGSLMAMGRGIDNAVVG
SDGKKHLPISISRNCGKTWTYHASPFPPIQGHQRLVLLRLKEGPIMLVSFTDHPTRTPKR
EQGMAFTDANGNSFIGYGAYVALSYDDGKTWPVQRLLTDGVERYLNGGAWTQFFTMDGTH
AEPRGYLAATQSPDGMIHLLGSRIHYAFNLACSVQIEVQRISG

Enzyme Prediction     

No EC number prediction in MGYG000002176_00812.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	101	400	5.9e-22	0.827485380116959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.11e-31	98	440	13	321	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	7.86e-23	110	439	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	5.67e-05	240	404	2	119	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
COG1262	YfmG	0.008	4	46	271	313	Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII65153.1	8.75e-216	2	451	208	657
QUT59623.1	1.72e-215	2	451	208	657
ABR39477.1	1.72e-215	2	451	208	657
QQY38330.1	1.72e-215	2	451	208	657
AII67866.1	3.53e-215	2	451	208	657

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999814	0.000208	0.000005	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002176_00812.