CAZyme Information: MGYG000002176_01561

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01
• CAZyme ID: MGYG000002176_01561
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		42723.66	8.1419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002176	2675847	MAG	Denmark	Europe

• Gene Location: Start: 8170; End: 9315 Strand: -

Full Sequence      

MKYFLLAGEASGDLHGSQLIKSIKQYDAEAQFSFFGGDMMASEAGVEPLVHYRNMAYMGI
VEVVKHLREILGFLSRAKRVIDQWQPDAVVLIDYPSFNLKVAKYAFSHRIKTFYFISPKV
WAWKEYRVKQIKKYITALYSILPFETEFFARHGYDVCYVGNPTVNEIGEARKQFADMATF
CKRNGLSQKPILAIVPGSRKKEISDNLPTMVRAASAFPDYQMVIAGAPGIDEAYYGEVLG
NECLACNIPVVEGQSFELVADARVALVTSGTATLETAVLGTPQVVCYRMGASKVVYFLYK
HFLKVKYVSLPNLIVGKEVIPELLLHHCDVPTVKHHLEQLLPDTEQRRAMLDGYEAMKQR
LGENSCTDTAAKMMIAALGQK

Enzyme Prediction     

No EC number prediction in MGYG000002176_01561.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	362	1.1e-111	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.59e-116	1	381	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.28e-113	1	376	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.03e-80	4	366	2	364	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.17e-72	5	376	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.36e-51	1	330	2	306	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMI80442.1	3.39e-128	1	381	1	379
QPH59250.1	1.37e-127	1	381	1	379
QBJ18940.1	1.37e-127	1	381	1	379
QUT60955.1	2.75e-127	1	381	1	379
QUT66360.1	2.75e-127	1	381	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	7.11e-40	5	380	11	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.11e-40	5	380	11	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3JAC1	1.62e-62	5	378	10	378	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q1D393	1.73e-60	2	378	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	1.77e-60	2	381	8	383	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	3.42e-60	5	378	8	378	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	5.22e-59	2	380	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002176_01561.