CAZyme Information: MGYG000002179_01210

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000002179_01210
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634		71131.56	4.498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002179	2310214	MAG	Spain	Europe

• Gene Location: Start: 3251; End: 5155 Strand: +

Full Sequence      

MRQYGQFLAAVLIFLAAVSCAEHRSGALRYGFPDIIDITLTPDSTVRKAGCFTDAGSWMG
FTLPQRDRWVNGFCGPFSIEHRRWAAQSAVTVRFAGDEGDMRPDSVTYFPGEVYMASSSD
AGRIEQRMVFASASTALLTVESGTDRGLVFTGEEWNSRARLSIEGQTVTAELPEGETVLL
TFGPEAVLECDGRNYTARTPEGCGLVRVALSFIYEGDAVEGVMREARALLTDPEAAVKAS
ADRWEGYLNRVLRDDMPKEYDRVAVKSVVTLMSNWRAARGDLLHEGVIPSHSVTYFTGFW
AWDSWRFSAALARFAPELARNNIRAMFDYQQPDGMVIDCIYTDSRWNNARDSKPPLACWA
VDEIMTYAGDTAFVREMYPKLLTYYKWWFAKRDHNGNGMCEFGSTDGTLEAAGWESGMDN
AIRFDGARMLRNGPDAWSLDQESVDLNAYLAFEARLLRKFAALIGEDFDAPDHSAEVADY
FFDPELGYFCDRKLADGSFIAEPACEGYTPFWVEIASQEQMDQALRLLTDPAKFSTYIPF
PTAAADNPKCSPDGYWRGPIWLDQTYQAIRGLRNYGYGDLADEYTRQVFDRCDGLTGDAP
IHENYGTHTGERLQASHFSWSASHLLMMYEDYGK

Enzyme Prediction     

No EC number prediction in MGYG000002179_01210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	211	632	1.7e-107	0.5228070175438596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	7.21e-133	8	632	7	783	alpha-glucosidase; Provisional
COG3408	GDB1	5.25e-17	300	629	285	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	3.52e-09	371	630	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	2.24e-08	352	633	178	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	0.002	412	586	324	497	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37311.1	0.0	28	634	32	638
QQA30340.1	1.05e-300	15	634	18	642
QUT61854.1	1.05e-300	15	634	18	642
QBJ18170.1	4.27e-300	6	634	4	642
QPH58462.1	4.27e-300	6	634	4	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.40e-81	52	632	32	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.25e-80	52	632	32	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.74e-80	52	632	32	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.30e-77	52	632	33	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
6XUX_A	6.27e-34	411	632	42	305	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	2.02e-80	52	632	55	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.01e-20	300	623	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	2.38e-20	300	623	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	1.56e-06	286	626	26	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000589	0.150604	0.848377	0.000181	0.000137	0.000112

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002179_01210.