CAZyme Information: MGYG000002181_00106

Basic Information

• Species: Paramuribaculum sp000431155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp000431155
• CAZyme ID: MGYG000002181_00106
• CAZy Family: GH84
• CAZyme Description: Hyaluronoglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1101	MGYG000002181_1|CGC2	121930.7	4.2781

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002181	2554789	MAG	Spain	Europe

• Gene Location: Start: 113388; End: 116693 Strand: +

Full Sequence      

MQIKPFVASVLLSFFALSASAYSIWPVPRTVTNKQESLDISSQITVVADEGVDQLTISRA
EQVLEKAGIDYTVSSTPSQGANLYIGVNGGNGTASQYAADHNVPLSVFSTTGQCFDPHVV
YVDGSSIVIIGDEEGSAFYGFATLEQIFEQREGNTLPGVIIEDYAHAKYRGLVEGFYGHP
WSMESRLNILDHMMRYKMNYYVYGPKADPYHAGNWRVNYPETVTDDQRKLGQITTSDIQQ
LATHAAACKVDFVWAVHPTLGSYYISLYWVDDIMTKFQQLYSLGVRHFGVSVDDMSGHPT
NQAQLPDKVQQAIDEKWNTADAAEADCVGNVLFVPTCYALNYGATYSLTPIQEISSKVEV
AFTGYDCFSNVRASSFGSMAEYIGRDPIFWWNNPVNDDHDTWLYMHGLTARWTIEQTGAV
DHMRGFLLNPMNQGQVSKICNFSAADYSWNPDAYNEQSSWEQALKSIVKTDENVKALKDF
IRVMSAYTTTETTSPEGEELKPLYQDFQSNYSSTSVPECTELKEAMQNCYDACLVIRTFK
DSEDPDLALFYTDIEPWLDKVQDMARIVLKSIEFMTQGASSLDHWTEYSDILALAQGIHT
NHKMSVLEGSGTSTYESMQEVHPTPKYLDPFIDFLAAELVNFAPQLPERDMSPKVITNLS
SLSGVSLKTDEAPRVLSGLNGISLKIGEYVGVCLNRIQTVTLTPPALPDGVVLEYSISGK
EWQQWNGEETLMAYFRLRGNSAEPAELTFDQLAYSVPVVSDDTTPEVSTNMGTWGAYNIT
NVIDGDNDTYFWSNNSQSVGDYVLLDFGASNPRGNISLVFNSGDHPTGTVEIQLSDNNST
WSTVASFSESDLTNNTYSCDAKGASARYVRLYLSSVSGGNWFQLAEFSVNSQTSATTSVA
VDSEGNAITQLNDISLTTHYAGNGKGYIEYQFIENIDIQEIHIYHNSHFTESNELPVIEV
YSNGEWVNAGVLDAVRTIIKVTDDMRHVTKLRISWTEGNAPDIYEVYPVGPDYVQPASDY
AGIDSVVSDSDSQIMFSTSRNILTVKAPCAIRSIEIADMSGRIITNATPNADYAVIPVSE
RIVIATVHLENGSTATRKITM

Enzyme Prediction     

No EC number prediction in MGYG000002181_00106.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	170	480	5.9e-72	0.9898305084745763

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	5.09e-121	170	480	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	2.12e-16	21	163	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	1.25e-07	768	886	6	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77745.1	0.0	9	1015	8	1025
AHF13697.1	1.89e-274	14	1071	17	1082
BCI64753.1	1.36e-262	8	1099	5	1112
AHF13792.1	3.95e-205	18	1099	5	1243
QFQ11845.1	5.11e-126	12	1098	15	1132

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PWI_A	2.43e-73	22	636	34	621	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
6PV4_A	5.90e-57	17	590	27	604	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
5MI4_A	8.13e-56	122	723	96	680	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	1.68e-55	122	723	84	668	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	1.70e-55	122	723	85	669	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	1.51e-58	17	889	34	943	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	1.24e-54	122	723	106	690	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.18e-40	26	513	48	514	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	4.72e-40	26	513	48	514	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q8VIJ5	4.75e-17	171	471	63	347	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000422	0.998876	0.000184	0.000178	0.000160	0.000150

TMHMM  Annotations     

start	end
5	27