CAZyme Information: MGYG000002183_01574

Basic Information

• Species: Collinsella sp900754445
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900754445
• CAZyme ID: MGYG000002183_01574
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		63110.63	6.2388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002183	1875914	MAG	Spain	Europe

• Gene Location: Start: 21; End: 1799 Strand: +

Full Sequence      

MPYAHKVVTEITCHGTGAVRLFGDHGTVIDVGGQDTKVIQLKGGRVAKFAMNDKCAAGTG
RFLEIMADRLGISQQQMADLARSGEPTKISSMCTVFAESEVISLIGRGEPRENIARGVID
SVVSRVATMAGQAAGAPYYLTGGLCENAFVVERLGELLGSPVTTSPQARFAGAIGAAVRL
GLGVYRDMRILNITAQKPDSTGSGTYLAALVREQIETGHRAAVLCGAAPGDTQSDIPAGV
PVYTVDFDTPELPFHICGMSDVMPYPSARYRDLTPSMLKAFERAFAAAIDRAVAEFRPDL
VLCHHLYLVTALARECVRGVPVVAVCHSTDLRQLRSHALERDRIVRAVRRLDAVFALHAE
QAEQIGLVCGVNADRIHVIGTGYDHRVFCRDASVARQPGSLVYVGKICFKKGVESLVRAV
SLPIDDDVRPSGLVLVGGRGDDAEYARIERLAAASDVPVTLAGRLDSDGLVRAYRSSDVF
VLPSFYEGLPLVTIEALACGCKVVATDLPGVRPWMEAMLLGAPVTWVASPRMTDVDTPVA
ADLPLFERALADAIAQALVAPPSTFEPSAVSWEACLGRILKVVDLLEGGSYG

Enzyme Prediction     

No EC number prediction in MGYG000002183_01574.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	401	513	1.9e-19	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1924	YjiL	6.74e-60	4	185	209	392	Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid transport and metabolism].
TIGR00241	CoA_E_activ	1.71e-57	3	178	70	247	CoA-substrate-specific enzyme activase, putative. This domain is found in a set of closely related proteins including the (R)-2-hydroxyglutaryl-CoA dehydratase activase of Acidaminococcus fermentans, in longer proteins from M. jannaschii and M. thermoautotrophicum that share an additional N-terminal domain, in a protein described as a subunit of the benzoyl-CoA reductase of Rhodopseudomonas palustris, and in two repeats of an uncharacterized protein of Aquifex aeolicus.This domain may be involved in generating or regenerating the active sites of enzymes related to (R)-2-hydroxyglutaryl-CoA dehydratase and benzoyl-CoA reductase.
pfam01869	BcrAD_BadFG	2.23e-39	3	178	82	269	BadF/BadG/BcrA/BcrD ATPase family. This family includes the BadF and BadG proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis. The family also includes an activase subunit from the enzyme 2-hydroxyglutaryl-CoA dehydratase. Aquifex aeolicus aq_278 contains two copies of this region suggesting that the family may structurally dimerize. This family appears to be related to pfam00370.
cd03801	GT4_PimA-like	1.03e-36	189	512	1	303	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03798	GT4_WlbH-like	8.88e-32	200	582	13	372	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY60222.1	6.36e-157	188	581	1	398
BBH49919.1	5.60e-145	188	587	1	403
SDR86382.1	1.04e-143	188	580	1	390
AJC11552.1	2.75e-130	188	590	1	406
QKF07020.1	3.89e-112	186	580	27	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HUX_A	3.26e-38	4	178	76	252	CrystalStructure Of The Acidaminococcus Fermentans (R)-2- Hydroxyglutaryl-Coa Dehydratase Component A [Acidaminococcus fermentans],1HUX_B Crystal Structure Of The Acidaminococcus Fermentans (R)-2- Hydroxyglutaryl-Coa Dehydratase Component A [Acidaminococcus fermentans]
4EHT_A	1.29e-29	4	178	73	250	ChainA, Activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridioides difficile],4EHT_B Chain B, Activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridioides difficile],4EHU_A Chain A, Activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridioides difficile],4EHU_B Chain B, Activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridioides difficile],4EIA_A Chain A, Activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridioides difficile]
6KIH_A	1.17e-13	401	512	247	359	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]
6TVP_A	1.55e-11	319	576	115	380	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]
2JJM_A	7.00e-07	243	511	45	319	CrystalStructure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_B Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_C Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_D Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_E Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_F Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_G Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_H Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_I Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_J Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_K Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_L Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39383	9.49e-40	1	178	67	246	Uncharacterized protein YjiL OS=Escherichia coli (strain K12) OX=83333 GN=yjiL PE=4 SV=2
P11568	1.38e-37	4	178	76	252	(R)-2-hydroxyglutaryl-CoA dehydratase activating ATPase OS=Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / CCUG 9996 / CIP 106432 / VR4) OX=591001 GN=hgdC PE=1 SV=2
G3KIM5	1.12e-34	4	178	73	250	Activator of lactoyl-CoA dehydratase (Fragment) OS=Anaerotignum propionicum OX=28446 GN=lcdC PE=1 SV=1
Q93AM0	1.50e-32	3	178	75	253	(R)-phenyllactate dehydratase activator OS=Clostridium sporogenes OX=1509 GN=fldI PE=1 SV=1
Q60315	2.11e-31	1	176	65	240	Uncharacterized protein MJ0004 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ0004 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002183_01574.