CAZyme Information: MGYG000002186_01210

Basic Information

• Species: Ruminococcus_A sp000432335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_A; Ruminococcus_A sp000432335
• CAZyme ID: MGYG000002186_01210
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599	MGYG000002186_14|CGC3	68701.26	5.5087

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002186	2911793	MAG	Spain	Europe

• Gene Location: Start: 61062; End: 62861 Strand: -

Full Sequence      

MYNTLSAQVNANKLSVMENKTSITESCFENRYTLSFHDSVAGNRTCLAQFPLKDEPFFHL
HLEYPMLGIAGIWTPVSGFQKHLTGDWSDFHQINLSHSAPVLCFFDTDGNNKITLAFSEV
SRDLFFNAGVHEENGCLSIDIILYFPVTVSNLTFNFRSFFSPENISSILPQVTLWWDHLL
TDAPLEVPEDARFPMYSTWYSYHQNVSHENLSREYALAKKLGMKAVIIDDGWQTADSNRG
YAFCGDWKAEETKFFDFREHIELIHSFDMKCLLWFSVPFVGENSSLWNTFKDMLLHHDHT
LKTGILDPRYPKVRDYLVSVYQKAVCEWNLDGLKLDFIDSFRAYPDTPSLHPEMDFTEIQ
DAVYVLMATISSTLKTLNSQLMIEFRQNYIGPQMRRFGNIFRVGDCPLSGITNRVGITDL
KLLSGNTAVHSDMIMWHSDESPEDVAIQLIHCIFGVLQISVRLNELNPEQYQVLENYLTF
SITYRKVLQQGTFTLTKPLSLYPLLQSRDENTCVIACYDNNQIIHLEKTPSKDFWILNGS
KGHLLYVQTEENFFDVEIKNCAGSTISSEICMPLSGIHTFPVSPGGMLHLKRKKEILTL

Enzyme Prediction     

No EC number prediction in MGYG000002186_01210.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.58e-67	191	486	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	3.26e-11	192	368	1	181	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	1.84e-09	184	337	284	442	Alpha-galactosidase [Carbohydrate transport and metabolism].
COG1649	YddW	3.47e-05	211	375	66	260	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].
cd14792	GH27	8.08e-04	194	369	2	148	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWH41655.1	2.89e-145	56	592	44	586
QWI48925.1	2.89e-145	56	592	44	586
QWH11404.1	9.17e-144	49	592	42	586
QWG32884.1	2.59e-143	56	592	44	586
QWG44322.1	2.59e-143	56	592	44	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PHU_A	5.12e-08	80	336	250	492	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	1.54e-07	80	334	250	490	ChainA, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999813	0.000176	0.000016	0.000001	0.000001	0.000010

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002186_01210.