CAZyme Information: MGYG000002186_02004

Basic Information

• Species: Ruminococcus_A sp000432335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_A; Ruminococcus_A sp000432335
• CAZyme ID: MGYG000002186_02004
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870	MGYG000002186_32|CGC1	99761.07	5.0649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002186	2911793	MAG	Spain	Europe

• Gene Location: Start: 5751; End: 8363 Strand: +

Full Sequence      

MRAVEVRLQNASMQAGIEKNPVIQWQYGEEDAGKRQSSYQIQILKEKGEICADTGEINSS
EQNNIEIPMELKSLHGYEIQVKVKSQDGEEEWGETGHFISGVQPGEWKGRWIGAGSSKPF
YVGKEIFLERKIKSAYMAVCGLGQFQIRVNQEQAGEGCLYGSWTDFEKRLHYWVFDVSGQ
VRQGVNEICMEVGNGWYIGDTSEGRHFYTMNHRYHAFGTELTGIIQMRIVYEDGTEELVV
TDESWGTWESPVTLANAYGAEDYDGEKACTWEELFLLFKKNKVKILSEEEKPQGCLVPAL
YPPVKILRTYSGKLLKKAGRKYLYDLGQNMSGFFEMTAKGEKGTILKITSAEKIDTDGNI
VPSTNTWSIWKMQGKGEIESYCPRFTYGAGRWILVEILQAPENCEPQIESVNGHFISSGA
KDTGKFSCSDKRYEEIHQLVKCAVESNLNHVHTDCPTVERMGWLEPNHLMGPSIMYLKNV
ETLWDKIGDDMRDAQYGEEEEDVDLGEFPHVYGAGLIPSIAPRYAKFIVDCGAGSFWDII
PWGSSLLLAEDLLADFYGNTRVIKKNYLAAAAYVEYLWKKYEDYPKIYGKDGTEHFLCHG
LGDWGTDRKEGECRENVETAYLYYDLCVLGKWANDQKDKERENWAKACAERVKREYNQSL
LQKDESGIWYYGGKGELKKEKMMANQALPLYLGMVPEDKEKDVKQTFLDLAEKGKIQSGE
ICLRYIFCMLSQYGKNEWIEKMIMQKEHPSYYRFIEKGETTLPEFWSDDARSRNHDMMGH
IMEWFYREVGGIYSRDGFKTVEINPHFVGNLSWIRCAYDSIAGKIEVFLQKKENRCTMEV
RIPTNMEAAIHLPEEKVSVCGGIHRFEYLV

Enzyme Prediction     

No EC number prediction in MGYG000002186_02004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	319	852	3.4e-106	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.54e-57	421	789	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.45e-36	131	306	2	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.82e-13	794	867	5	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	5.02e-11	321	417	7	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL25376.1	1.73e-170	109	850	5	748
AIQ51389.1	1.70e-167	21	853	23	840
QBE95492.1	3.41e-161	107	840	5	743
BCS07621.1	8.89e-122	25	858	26	885
BCR95051.1	8.89e-122	25	858	26	885

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.43e-100	19	854	49	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.91e-51	129	855	313	997	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	8.50e-43	18	866	20	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	7.33e-58	19	858	49	912	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.53e-50	129	855	313	997	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.45e-36	91	862	129	887	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002186_02004.