CAZyme Information: MGYG000002186_02253

Basic Information

• Species: Ruminococcus_A sp000432335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_A; Ruminococcus_A sp000432335
• CAZyme ID: MGYG000002186_02253
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	MGYG000002186_40|CGC1	64654.49	5.0562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002186	2911793	MAG	Spain	Europe

• Gene Location: Start: 21622; End: 23337 Strand: -

Full Sequence      

MWEKEKNRDDIFRVWDTKALQGVHEDPCRRALFTPKKVLWTAGEVINSEVLLEQRELQIS
LGAHEPCVMKSRKGKMASILLDYGQEIHGGIKLLVWNSNVLQGAKVRIRFGESAAEAMAE
LGGEKNATNDHARRDLRMEVGMMSMNPVGETGFRFVRIDLEETQGEIWLKSVPAVFVYKD
VEYKGSFLSSDPLLNRIWDVGAYTVHLNMQEYIWDGIKRDRLVWVGDMHPETTTIQAVFG
EDDAVERSLDFIREETPLPGWMNGMASYTMWYVIIVYDWYFHTGKKAFLEKQREYLEGAA
DQLSEYIDEEGKDTVKEGRFLDWPSEGKGAVVDAGVQAIHAWAAASLQKIFQVLGDENRA
ERCRADLKRLRACKMDYQDSKQAAALLVINGMEDPGEVNERLLKKGGAQGMSAFMGYYIL
TARAMAGDYQGCLDCIRDYWGGMLSLGATTFWEDFDVRWLENAARIDELPAEGKIDVHGT
YGAYCYSGYRHSLCHGWASGVTPWLSENVLGIQVLEAGCRKVKVDPHLGDLEWAKGAYPT
PYGLIRVSHRKREDGSIDTQIQAPEEIEVVK

Enzyme Prediction     

No EC number prediction in MGYG000002186_02253.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	77	568	1.2e-101	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.58e-13	185	509	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.47e-06	511	565	1	55	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ98689.1	3.24e-219	26	570	10	557
QBM20341.1	6.31e-218	26	570	22	565
BBH21551.1	2.65e-215	21	570	5	556
QMV41231.1	5.15e-213	22	570	4	556
ATP57578.1	2.30e-210	27	570	38	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	6.91e-39	54	547	169	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	5.03e-11	78	498	94	531	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	1.25e-10	78	564	367	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002186_02253.