CAZyme Information: MGYG000002190_01197

Basic Information

• Species: Clostridium sp001916075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp001916075
• CAZyme ID: MGYG000002190_01197
• CAZy Family: GH16
• CAZyme Description: Beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000002190_9|CGC3	27362.49	5.6305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002190	2598727	MAG	Spain	Europe

• Gene Location: Start: 68778; End: 69503 Strand: +

Full Sequence      

MKIKLSKIITGILLAGTLLSTQVSALTTSHFGDGLSYMNSRDWSKSDGWSNGGMFDCTWR
GQNVNFYNGTMELAITRDYQGGVSQYAGGEYRSNDTYGYGLYQVRMKPAKNTGVVSSFFT
YIGPTDNSPWDEIDIEFLGKDTTKVQFNYYTNGVGNHEYLYDLGFDASQSFHTYAFNWQP
NYIAWLVDGKEVYRAYDNIPSHPGKIMMNLWPGKNVDSWLGRFNGATPIKAYYDWVSYDP
M

Enzyme Prediction     

No EC number prediction in MGYG000002190_01197.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	36	236	3e-92	0.9757281553398058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02175	GH16_lichenase	3.54e-121	31	240	1	212	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
COG2273	BglS	2.07e-57	31	238	47	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
pfam00722	Glyco_hydro_16	5.28e-53	59	236	1	167	Glycosyl hydrolases family 16.
cd00413	Glyco_hydrolase_16	8.80e-37	42	236	12	207	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02176	GH16_XET	9.49e-27	55	190	10	142	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF58046.1	2.46e-136	1	241	6	246
AQR96736.1	2.86e-135	1	241	6	246
ADL52419.1	2.97e-135	1	241	1	247
BCZ45550.1	3.88e-133	1	240	6	245
BCZ47763.1	5.71e-133	11	241	16	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3I4I_A	8.14e-115	29	241	22	234	Crystalstructure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome [uncultured murine large bowel bacterium BAC 14],3I4I_B Crystal structure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome [uncultured murine large bowel bacterium BAC 14]
1MAC_A	3.93e-96	29	238	2	209	CrystalStructure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
3O5S_A	1.34e-95	20	238	19	235	CrystalStructure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
3WVJ_A	1.71e-94	36	240	13	215	ChainA, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
1BYH_A	3.98e-94	27	238	2	211	MOLECULARAND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45797	1.66e-98	23	238	22	235	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1
P23904	3.74e-97	23	238	21	234	Beta-glucanase OS=Paenibacillus macerans OX=44252 PE=1 SV=2
P04957	1.80e-96	8	238	11	239	Beta-glucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=bglS PE=1 SV=2
P07980	3.78e-95	1	238	1	236	Beta-glucanase OS=Bacillus amyloliquefaciens OX=1390 GN=bglA PE=3 SV=1
A3DBX3	3.96e-92	36	240	42	244	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.999090	0.000183	0.000179	0.000159	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002190_01197.