CAZyme Information: MGYG000002191_00904

Basic Information

• Species: CAG-313 sp000433035
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; CAG-313; CAG-313 sp000433035
• CAZyme ID: MGYG000002191_00904
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		32045.24	6.2134

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002191	1773949	MAG	Spain	Europe

• Gene Location: Start: 251; End: 1135 Strand: +

Full Sequence      

MKKVLSLICVFSICLLLGFTTEPKSVSAAGDPNLHQLILTNNDCYKAGQYITPTGIMVHS
TGANNPNLRRYLAPNDGLIGVNTGGNHWNQAKPDGQQKCVHAFIGKLADGTVATYQTLPW
NMRGWHAGGAANNTHIGFEICEDDLTDANYFNAVYQEAVELCAYLCELYNFNPLADGVII
GHFEGYQRGVASNHADPGHWFSKFGKTMNDFRQAVYNEMNETTTLYCVQVGAFSVRANAE
ALLTQIKAAGFDGYIKTYGTLYCVQVGAFSVRANAEAVLAEVKAAGFDAFIKIE

Enzyme Prediction     

No EC number prediction in MGYG000002191_00904.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06583	PGRP	3.19e-27	53	200	2	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
pfam01510	Amidase_2	2.65e-18	52	198	1	120	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
pfam05036	SPOR	6.35e-16	226	292	5	75	Sporulation related domain. This 70 residue domain is composed of two 35 residue repeats found in proteins involved in sporulation and cell division such as FtsN, DedD, and CwlM. This domain is involved in binding peptidoglycan. Two tandem repeats fold into a pseudo-2-fold symmetric single-domain structure containing numerous contacts between the repeats. FtsN is an essential cell division protein with a simple bitopic topology, a short N-terminal cytoplasmic segment fused to a large carboxy periplasmic domain through a single transmembrane domain. These repeats lay at the periplasmic C-terminus. FtsN localizes to the septum ring complex.
smart00644	Ami_2	1.49e-14	52	182	2	117	Ami_2 domain.
TIGR02223	ftsN	3.74e-07	226	294	228	298	cell division protein FtsN. FtsN is a poorly conserved protein active in cell division in a number of Proteobacteria. The N-terminal 30 residue region tends to by Lys/Arg-rich, and is followed by a membrane-spanning region. This is followed by an acidic low-complexity region of variable length and a well-conserved C-terminal domain of two tandem regions matched by pfam05036 (Sporulation related repeat), found in several cell division and sporulation proteins. The role of FtsN as a suppressor for other cell division mutations is poorly understood; it may involve cell wall hydrolysis. [Cellular processes, Cell division]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOT72278.1	7.00e-104	33	215	2	184
AEY67694.1	1.72e-90	33	240	2	220
ABZ85376.1	3.01e-90	33	215	2	181
CDM67796.1	9.67e-89	33	215	2	181
QAT44066.1	2.13e-88	33	215	2	181

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999024	0.000243	0.000166	0.000151	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002191_00904.