CAZyme Information: MGYG000002192_01397

Basic Information

• Species: Acutalibacter sp900543305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp900543305
• CAZyme ID: MGYG000002192_01397
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	MGYG000002192_15|CGC1	81985.23	4.7968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002192	2487718	MAG	Spain	Europe

• Gene Location: Start: 10955; End: 13216 Strand: +

Full Sequence      

MLYQDAARSPRERAEDLLSRMTLREKVGQVNQRLYGFAAYTREGGEIRLSTEFREEVEKY
GGLGVLYGLYRADPWSQKDFSNGLWGIHMKRAYNLAQKYVLDHSRLGIPMLMSTECPHGH
QALDGYLLPVNLGVGAAWNPELTREAYQVCGRQLKELGVDYALISMLDVLRDPRWGRSEE
CYSEDPYLCATLAKAAVTGCQEEGVPVVAKHFCAQGETTGGVNASAARIGPRELREIHLP
PMKACCEAGVEGVMAAYNEIDGVYCHANETLLKHVLREELGFTGAVMADGTAIDRLDNLT
GSSAASGALALQSGVDISLWDQGFSHLEEAVEQGLVAEEELDRAVLRVLELKFRQGLFEH
PYLPEEEPEVFSGEQYPQSLELARQGAVLLKNSQGILPLAAQGKKIALIGPNAHSIYNQL
GDYTPQLREGEGITLLQGLEQELGAGSVAYAPGCPVCGDDTSGIAPAVKLAQESDLVILA
VGGSSSRFAGARFDINGAAIMDGEVQMDCGEGVDCSTLTLPGVQEELCRAVLQTGKPVVA
VVIAGRPYAIPQLCQEAQAVVYSFYPGPWGGQALAEILLGKVCPSGRLPASLPRSVGQLP
CYYNPKSSYVPMKYRDQQDTALYPFGFGLSYTTFAAQQVRFPAKISLEELRAGKRAQVTF
TLKNTGDRDGYGVPQLFIHDVQATTVRRVRELKAYHKVFLKAGEEKECTLSLGWQELGLW
NLAMEFTPEPGDVELFLEEGGTSLAQGVLKITA

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	103	319	2e-62	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	8.03e-147	15	737	39	750	beta-glucosidase BglX.
COG1472	BglX	3.46e-87	21	456	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.01e-62	167	650	158	652	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	5.45e-62	22	351	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	2.14e-58	387	631	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ61803.1	4.14e-301	2	749	4	781
BCJ98686.1	1.57e-298	2	752	4	784
ASM70685.1	2.89e-297	14	751	10	747
BCJ95064.1	1.23e-287	12	751	13	782
QQO08493.1	8.65e-284	3	740	4	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	2.26e-109	3	733	36	766	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	1.57e-99	3	731	7	735	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
6R5I_A	3.98e-99	103	737	67	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
7EAP_A	1.16e-98	3	731	7	735	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5O_A	2.12e-98	103	737	67	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	1.16e-99	16	751	40	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	1.20e-98	16	751	40	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	1.01e-97	3	743	29	743	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
T2KMH0	9.54e-97	103	731	60	700	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	3.61e-73	18	735	43	759	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999557	0.000418	0.000038	0.000002	0.000001	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002192_01397.