CAZyme Information: MGYG000002193_00278

Basic Information

• Species: QANA01 sp900554725
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Christensenellaceae; QANA01; QANA01 sp900554725
• CAZyme ID: MGYG000002193_00278
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000002193_14|CGC1	42690.27	4.444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002193	1519398	MAG	Spain	Europe

• Gene Location: Start: 7553; End: 8722 Strand: -

Full Sequence      

MNRFFISLFALVALCAALLTGCQQVPGEIERHPVISFSVTEVPVHSAAVPSPSVFQDPLQ
ERLDGMTLQQKVGQLFFARFPQDNDALEEIETFQPAGYILFGVNFENSNPETLKATLKKC
QSVSEIPLLFGVDEEGGTVVRASKYSTFRSEPFASPQKLYQQGGLQRIAEDAEEKSRFLK
ELGFTVNLAPVSDVSTDPQDFIYARSFGQPAEQTAEYVSTVVKAMQKTGVSPVLKHFPGY
GNNVDTHTGSALDDRSYEQFLESDFLPFQAGIEAGAPAILISHNIVRCMDEQYPASLSKK
AHDVLREDLGFEGIIMTDDLAMDAVSSYSGSKSSAVLAVLAGNDLLISSDLPSQYRSVLE
AVEQGEISQQMLDRAVLRVLRWKESLGLL

Enzyme Prediction     

No EC number prediction in MGYG000002193_00278.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	122	346	5.9e-46	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.47e-65	66	389	1	318	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.33e-60	67	381	1	315	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.12e-31	96	324	27	255	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.01e-17	48	388	20	358	beta-glucosidase BglX.
PLN03080	PLN03080	0.010	258	388	239	368	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW43722.1	1.87e-126	40	389	35	388
QHQ63470.1	1.59e-124	19	389	18	414
SET88834.1	9.35e-124	61	389	92	417
AYH39956.1	1.07e-122	53	389	181	516
BCI61427.1	1.65e-121	34	389	126	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.88e-38	66	384	11	338	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.23e-34	66	388	42	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.00e-34	66	388	16	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	5.94e-34	66	388	46	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6GFV_A	7.35e-31	126	383	73	337	Mtuberculosis LpqI [Mycobacterium tuberculosis H37Rv],6GFV_B M tuberculosis LpqI [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	6.74e-34	66	388	42	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
L7N6B0	8.59e-30	126	383	116	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
A0A0H3M1P5	1.19e-29	126	383	116	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
Q0AF74	1.55e-28	97	385	30	316	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
Q82SJ8	3.64e-26	97	347	30	281	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000036	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27