CAZyme Information: MGYG000002200_00192

Basic Information

• Species: CAG-822 sp000432855
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-822; CAG-822 sp000432855
• CAZyme ID: MGYG000002200_00192
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	MGYG000002200_3|CGC1	48340.4	9.3033

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002200	1363105	MAG	Spain	Europe

• Gene Location: Start: 34437; End: 35708 Strand: +

Full Sequence      

MIIVLIISLLYLVFAICINLNWIQDIACYFGYPIAIYLVTFVALIPGFIYVFTLLSILLE
KNKRKTCTKQECDVAVLVPIYNAKKTIKKTIESITCQKYHGNIHIIAIDDGSADESLELL
KKINCDNQITILETKHRGKSYALNEGLKHVQTDYVITVDSDTTLHPLAIKNIMDKLVNSD
KNIVATAGAIFVKNDQTSFVTKLQQWDYTLGIFGVKLYQGSYHSTLVAQGAFSAYKTEKI
KEIGGWRPCVGEDIVLTWNLLSKGYQTNFAKNAVAFTETPDTFKGLFRQRQRWARGMIEA
FKQTKIITSKKLNLKSKFLMCMNIFFPFVDFALLIFIPLGLIFLLFHNNLFIGLLTLLVI
LLGMILCLVIEIKRQNVFREIDCKLEKRSILAFIFYALFYAFILAPFCLTGYIKELVNTK
KEW

Enzyme Prediction     

No EC number prediction in MGYG000002200_00192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	73	296	3.2e-33	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	2.73e-49	21	405	4	387	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.71e-43	76	253	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	5.06e-33	28	311	13	294	N-glycosyltransferase; Provisional
cd06434	GT2_HAS	6.52e-33	73	296	1	231	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
cd06439	CESA_like_1	3.26e-31	29	300	2	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB20290.1	1.27e-89	8	423	30	444
ACL76336.1	1.79e-89	19	423	41	444
AST57368.1	2.53e-89	8	423	30	444
ACI16970.1	7.74e-89	11	423	36	447
AQS57715.1	3.07e-88	8	423	33	447

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	7.14e-13	74	269	7	207	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7A351	1.32e-27	45	296	19	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q5HCN1	1.32e-27	45	296	19	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	1.32e-27	45	296	19	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q9RQP9	1.32e-27	45	296	19	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q99QX3	1.32e-27	45	296	19	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
2	24
34	56
324	346
351	370
391	413