CAZyme Information: MGYG000002200_01365

Basic Information

• Species: CAG-822 sp000432855
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-822; CAG-822 sp000432855
• CAZyme ID: MGYG000002200_01365
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000002200_73|CGC1	41926.76	6.4216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002200	1363105	MAG	Spain	Europe

• Gene Location: Start: 1215; End: 2279 Strand: -

Full Sequence      

MKICVYAICKNEEKFAKRWYNSMKEADKIFVLDTGSIDGSVDTLKKLGAVVKQEEIKPWR
FDVARNKSLDMVDEDADICVCTDLDEVFEAGWRKKLEKIWVSGTTRASYTYNWSLDDDDN
PIVSFYSDKIHARDGYKWTHPVHEVLSYDGVEKRVFDESIVINHYPDRSKSRGSYLPLLE
LSVKEHPEDDRNTHYLGREYMYYERWNEAIDTLIRHLNLKRATWKDERCASMRFIGRCYK
HLNRPLEAEMWYQKALKEAPHLKEAYTELALLYYDEGEYAKAIPLLEKALSIKKGYKTYI
TEWFSTDFSIYDVLSICYFNLGNYQKSLDYIDKALDINKDERLVKNRKLILEKM

Enzyme Prediction     

No EC number prediction in MGYG000002200_01365.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00006	TPR	5.45e-14	235	336	7	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	4.28e-12	194	291	5	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
cd02511	Beta4Glucosyltransferase	4.50e-10	2	166	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam13424	TPR_12	2.62e-08	265	340	5	77	Tetratricopeptide repeat.
sd00006	TPR	2.96e-08	264	340	2	67	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42689.1	2.37e-120	1	302	1	305
QIA29496.1	2.37e-120	1	302	1	305
QQR04409.1	2.37e-120	1	302	1	305
QAT50106.1	9.90e-120	2	309	5	314
AQS58818.1	1.34e-119	1	313	4	318

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002200_01365.