CAZyme Information: MGYG000002203_02040

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000002203_02040
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	MGYG000002203_27|CGC1	31820.01	5.0218

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002203	2806770	MAG	Spain	Europe

• Gene Location: Start: 12757; End: 13602 Strand: -

Full Sequence      

MKQLLMVAAALCLSAPLAAQSRLETFTLHSAILNTEKTCTVYLPDGYDSDTTRRYPVLYL
LHGAAGCHTDWSVKGNMRQIADEAFATGAALPMVVVMPDAAGEGENYTGRHMGYFNVPGW
EYERFFFEEFLPGVEEHYRILADKEHRAISGLSMGGGGTAAYALHHPELFSSACPMSGLL
DGYATPNDRGEVFRQSIADNSPVKILREMSDEELDTVRTIRWWVDCGDDDFLWRYNIDFY
ALMRERNVPLQYRMRDGGHTWRYWQTVLPDVLMFVSNGFAR

Enzyme Prediction     

No EC number prediction in MGYG000002203_02040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	30	274	5.8e-60	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.62e-29	40	281	38	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	6.70e-26	27	274	72	294	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	2.43e-25	30	272	1	243	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG4099	COG4099	1.15e-06	42	178	179	302	Predicted peptidase [General function prediction only].
COG4947	COG4947	1.39e-05	149	269	105	224	Esterase/lipase superfamily enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA30430.1	2.38e-34	29	268	154	389
QUT61959.1	2.38e-34	29	268	154	389
QMI79541.1	2.38e-34	29	268	154	389
QUT65236.1	6.43e-34	29	268	154	389
QJW91289.1	7.83e-34	30	271	146	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	2.59e-77	14	281	3	274	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	2.76e-33	30	270	139	379	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	1.04e-22	30	277	39	259	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	2.78e-22	30	277	39	259	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	1.84e-21	41	178	157	297	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	8.22e-21	30	277	58	278	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	1.15e-19	41	272	449	665	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	8.00e-18	23	206	500	671	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P9WM38	6.19e-11	22	178	173	319	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	6.19e-11	22	178	173	319	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000283	0.999075	0.000163	0.000156	0.000142	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002203_02040.