CAZyme Information: MGYG000002205_00487

Basic Information

• Species: Porphyromonas sp900546675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas sp900546675
• CAZyme ID: MGYG000002205_00487
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		57008.78	7.7497

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002205	2092439	MAG	Spain	Europe

• Gene Location: Start: 33767; End: 35290 Strand: -

Full Sequence      

MKQILQRLLLLTMSLLLVTATLMAQAPLRHVVKKQETVYSISKRYGVSEEEIYRLNEGSQ
WGIREGQTLLIPQGKPDTIYVEAPAVAQTEPGIHVVQSGETLYSISRKYGLTVSKLLELN
PQKHDAQIAVGERMVVASGAKLEQAPNPLNGNQLEQVRVALILPLRESGQPSRYLHFYEG
ALLAIERLQRQGVNIDLQVDAAVNSSALEQLLKSKEGERYDLIIGGDSEQSVELLAQRAK
AQQAVYLSPFVWQSGRGQLYDLFFQLNPAQYRVTQRLQSAFVERYAGCEVLLVRCGEGDQ
ADKFKAIETACREAGISTQSRSLRELTIGQWPRLSGKKCVILLNSSKQQDLTAVLDAMRD
AQLSTNDYQLFGYPQWQTYGKNIDERLQAVGATIFSTFYWDRELPESQQVRDAYKHWYGR
DIEEGYPSYAMLGYDVVRYFIAALSSYGRGFQQYQHQLPSDGLQSGFLFAPAVTGHNSGK
GGYTNLNLFFITYSPRGVKRQQIPLAE

Enzyme Prediction     

No EC number prediction in MGYG000002205_00487.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	9.73e-12	93	136	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG1388	LysM	1.66e-11	41	148	1	122	LysM repeat [Cell wall/membrane/envelope biogenesis].
smart00257	LysM	2.15e-10	93	136	1	44	Lysin motif.
cd00118	LysM	1.56e-09	30	71	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	3.75e-09	30	72	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE13417.1	0.0	1	507	1	507
ATS00530.1	1.71e-78	30	500	37	496
ATS06910.1	1.71e-78	30	500	37	496
ATR99267.1	2.41e-78	30	500	37	496
ATS02331.1	2.41e-78	30	500	37	496

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54421	3.31e-06	32	125	90	182	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.040845	0.954442	0.003850	0.000306	0.000256	0.000267

TMHMM  Annotations     

start	end
7	24