CAZyme Information: MGYG000002205_00969

Basic Information

• Species: Porphyromonas sp900546675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas sp900546675
• CAZyme ID: MGYG000002205_00969
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000002205_21|CGC1	41927.48	9.2486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002205	2092439	MAG	Spain	Europe

• Gene Location: Start: 3635; End: 4771 Strand: -

Full Sequence      

MKYLLIAGEASGDEHGARLIASLKAVDAKAAFAFIGGDKMAQQAGIAPLYHYREIAVMGF
TSVLRSMRKIRLAAHLLQEEMRSNPPDVVIPIDYGGFNLRYTLPMAHRHGVPVVYYIPPK
VWASRRRRIKRLQSYTDLCLTILPFEADYLSQRGVTARYVGNPSIQSVGKLLDSNAKLCD
TARPYIALLPGSREAEIARNLPIMCRAVDLLPAPWRAVIAGAPSIDRAHYTPYLSERIEL
VTDETLPLLAGASAALVTSGTATLETALIGTPQVVAYRLPAGRLARWAFDHLLPIRYFSL
VNLIAESPVVEELLGDAVTPQRLVQALNPLLDRESTAYQTQQAQYRMVRQRLEPSRVASQ
VAAERIYHALSTQWESEE

Enzyme Prediction     

No EC number prediction in MGYG000002205_00969.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	352	1.9e-98	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.73e-95	1	364	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.32e-88	1	372	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.96e-71	4	356	2	363	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.46e-66	4	363	9	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.78e-48	1	334	2	319	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12174.1	1.06e-257	1	378	1	378
SQH73726.1	8.68e-102	1	331	1	338
QUB42945.1	3.39e-97	1	323	1	326
ATS09476.1	1.01e-92	1	362	1	366
ATS02318.1	1.43e-92	1	362	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	9.25e-40	5	338	11	352	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	9.25e-40	5	338	11	352	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6ALW0	4.32e-57	4	331	13	350	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q1D393	3.08e-56	2	325	6	335	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B6J161	8.30e-54	4	335	7	341	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
B6J9H1	8.30e-54	4	335	7	341	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9KC41	8.30e-54	4	335	7	341	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002205_00969.