CAZyme Information: MGYG000002209_00312

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462
• CAZyme ID: MGYG000002209_00312
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		55952.07	6.1907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002209	3647221	MAG	Spain	Europe

• Gene Location: Start: 18013; End: 19530 Strand: +

Full Sequence      

MNLKKIILLFMAGAQLSACHSPQPKETGFEWGVVPQHPDLSWADSVGNRYESNNKVAVSA
NSFGAVADSSILSTDAIQKAIDHCAAAGGGTVTLEPGYYQTGALFVKSGVNLKIDKGVTL
LASTDIHNYPEFRSRIAGIEMVWPAAVINVVNEKNASISGKGTIDCRGNDFWDRYWNMRK
EYEAKGLRWIVDYDCKRVRGILVERSTDISLSDFTLMRTGFWGCQILYSDHCTVDGLVIN
NNVGGHGPSTDGIDIDSSTNILIENCLVDCNDDNICIKAGRDADGLRVNRPTENVVIRNC
TARKGGGLIVCGSETAGSIRNVLGYDLKAEGTSTVLRLKSAMTRGGTIENIYVTRVEATG
NRNVLSADLNWNPSYSYSKLPEAYKYDEIPKHWKVMLTPVDPPEKGYPHFRNIYLSQVKA
ADVEEFIHASGWNDSLRLENFYLYDIETQAKRAGKISLTRNFNLTNTKLNIDDKQPVSLE
KNVDDNISLEYIRNTDTQLVENKVH

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	83	454	3.3e-60	0.9292307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.05e-62	57	368	82	402	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	6.86e-15	111	351	21	229	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	1.03e-05	158	340	117	270	Probable polygalacturonase At3g15720
PLN02218	PLN02218	4.84e-05	58	371	68	355	polygalacturonase ADPG
pfam13229	Beta_helix	7.77e-05	200	321	48	155	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ43490.1	1.29e-281	1	495	1	495
QUT42006.1	3.68e-281	1	495	1	495
QMW86498.1	5.23e-281	1	495	1	495
QQA07711.1	5.23e-281	1	495	1	495
QUT69822.1	5.23e-281	1	495	1	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	8.87e-42	63	461	50	440	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	4.73e-29	63	372	33	363	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
2UVE_A	3.64e-22	26	387	123	521	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	1.56e-18	67	356	20	299	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4MXN_A	1.26e-09	63	240	27	190	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	2.64e-29	63	353	68	353	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	1.86e-24	58	387	152	514	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P26509	7.98e-18	32	356	15	325	Endo-polygalacturonase OS=Pectobacterium parmentieri OX=1905730 GN=pehA PE=1 SV=1
P18192	4.63e-17	67	356	46	325	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
P20041	1.05e-13	8	379	7	403	Polygalacturonase OS=Ralstonia solanacearum OX=305 GN=pglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000803	0.999238	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002209_00312.