CAZyme Information: MGYG000002209_02326

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462
• CAZyme ID: MGYG000002209_02326
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
869		100540.07	7.0199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002209	3647221	MAG	Spain	Europe

• Gene Location: Start: 4547; End: 7156 Strand: -

Full Sequence      

MNNKNNFSALPKIFDEELEYAIQTDHFIEKSKTEIKTESEFIPEYNKCQIQSDYSRNNQQ
VVCFIPYINPEQTSQIIETLREEKEIYKIILLTTKESKEKWFNRCPIAQTDCLFSSYTMQ
LICQYCDVLTTQILLYTGTTPFKFGYKALERLLQVTHHSLAGFAYSDFYEIKNGKRISHP
LIDYQPGSLRDDFDFGSLYLFRSDWFLQIALNMPKLQYAGLYYMRLFINKMSIESPLHIN
EFLYTQEENDHRVSGEKQFDYVDPKNREVQIEMEKVCTEYLKHINAYLPSYQYESLDKYW
RRYPISGASVIIPVRNRVRTIGDAIRSALQQQCEKDFNILVVDNHSTDGTSEVIEQFAVK
DPRVIHIIPEQDDLGIGGCWNLAIDHPNCHNVAIQLDSDDLYSDQNVIQKILSVFLSKKC
AMVIGSYRMTDFDLNTLPPGIIDHREWTPDNGRNNALRINGLGAPRAFYTPILNEIPFPN
TCYGEDYATVLAISRKYNIERIYDVLYLCRRWEGNSDAALSIERINANNFYKDKIRTIEL
GARIQYMKQEYNFVSDSALKSFYREQMSLWREANANHKALRNVQARQLSETISVQYNPGR
IVSTGAKMDASTLKRRACFLCKKNRPKEQISLPCFRHFEVLVNPYPIMPLHFTIANIKHM
PQTLSANLEAFIIHVKKLTNYIHIYNGPKCGASAPDHLHFQAFQSGSLPVCKTVETHLYG
KYLILSQKLDGTRMYALTDIEVPMFVIESKSPHTKVIFDFIQKAIQSLPVIVGENEPRLN
LIGWTPKKAHTLFAIIPRSKHRPDCYGQEEGQMLISPGAIDMGGLLITPRKEDYDNITLD
KARSILQEVAFSKNEMENAIHKLIDIINE

Enzyme Prediction     

No EC number prediction in MGYG000002209_02326.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	309	441	2.5e-19	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	7.46e-64	676	857	10	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
cd00761	Glyco_tranf_GTA_type	8.16e-21	310	429	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	1.83e-17	309	571	6	250	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00535	Glycos_transf_2	5.78e-17	309	468	1	156	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	5.88e-16	309	425	1	111	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH16693.1	6.41e-249	60	863	4	802
AND20203.1	2.27e-248	63	865	7	818
QUT83514.1	2.27e-248	63	865	7	818
QJR63544.1	4.54e-248	63	865	7	818
QJR67806.1	4.54e-248	63	865	7	818

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32268	3.40e-09	309	496	9	189	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
A0A0H2UR96	4.38e-06	309	515	6	220	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
O06483	6.42e-06	308	427	3	118	Uncharacterized glycosyltransferase YfnE OS=Bacillus subtilis (strain 168) OX=224308 GN=yfnE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000010	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002209_02326.