CAZyme Information: MGYG000002210_01389

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; RUG12045
• CAZyme ID: MGYG000002210_01389
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489		55044.81	3.9559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002210	2586109	MAG	Spain	Europe

• Gene Location: Start: 556; End: 2025 Strand: +

Full Sequence      

MLANGETCFQESADRWNGYLATIEKDDTQVGKQYKKAAVKAIETMMTNYKSAAGDLLHGG
VVPSMSYMWFIGLWAWDSWKQVVGMAKYNPDAAIENVRSIFDYQIQEDDEVRPQDAGAII
DCIFYNKGPERGGDGGNWNERNSKPPLAAWAVYNAYIESGDTEFLDEMYPKLVAYHNWWY
TNRDVDGNGVAEYGGMVHDSHYQYDENGELVLDENGNPMVDAEAVIEAAAWESGMDNAPR
FDVSGNGPDDVGTLVYEVKNDEGQVVGYTINQESVDLNSYLYAEKGFLKAMAEELGLEED
AAKYEEEAAALRDYINTYMYDEETGFYYDLQINEDGSEKKLLVNRGKGCEGWLPLWAKVA
DQEQADQVVEKMMDEECFNLTVPLPVTSKDNDMFEADKYWRGPVWLDQAMYGIEGMKNYG
YDAEAKELVEKMFQNAEGLLGDGPIRENYNPLTGEGLHTKNFSWSAACFYLLYENVLAGD
GTTCQTGIE

Enzyme Prediction     

No EC number prediction in MGYG000002210_01389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	2	477	1e-114	0.49122807017543857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	1	475	274	782	alpha-glucosidase; Provisional
pfam01204	Trehalase	8.11e-12	143	465	178	497	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	2.59e-08	275	466	252	486	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	1.81e-06	275	437	354	504	Neutral trehalase [Carbohydrate transport and metabolism].
COG3408	GDB1	0.001	145	449	341	578	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK21330.1	7.81e-236	1	489	298	802
QQP70135.1	5.22e-234	2	489	310	797
QQY26327.1	1.55e-232	1	489	291	795
QQV06747.1	6.22e-232	1	489	291	795
QMW74875.1	6.22e-232	1	489	291	795

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	8.81e-133	12	475	258	755	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	4.91e-132	12	475	258	755	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	6.93e-132	12	475	258	755	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	4.64e-126	12	475	259	756	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	7.29e-62	190	475	5	304	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	8.89e-132	12	475	281	778	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8T3S4	1.18e-19	74	475	98	488	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
D8QTR2	2.81e-19	74	474	98	487	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
P94250	5.75e-11	77	452	62	356	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
Q757L1	1.82e-06	274	471	479	701	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999556	0.000403	0.000049	0.000002	0.000001	0.000027

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002210_01389.