CAZyme Information: MGYG000002212_02181

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia
• CAZyme ID: MGYG000002212_02181
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	MGYG000002212_103|CGC1	57056.17	4.9158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002212	3172791	MAG	Spain	Europe

• Gene Location: Start: 8913; End: 10406 Strand: +

Full Sequence      

MSMESRIEVSEALKKAREYEQKNITEEVNRQKPSFHVCAPIGWINDPNGFSVYKGEYHLF
YQYYPYAKAWGPMHWGHSVSKDLVNWKNMPAALAPDKDYDHAGCFSGSALEYEGQHVLLY
TGVEEKETEDGKQIRQTQCLAIGDGVDYRKTEGNPVIYPDGLPQGSSLEDFRDPKIWQEG
DTFYAVMGSRSSDGSGQIPVYSSKDLQNWSLVSILDKCENQYGKMWECPDFFFLDGKAVL
LTSPQDMESEGLEFHSGNGTLCIIGNCSKEDFILHREKVQAIDYGLDFYAPQTTLTPDGR
RVMIAWLQSWDNYLSPESLAWGGMMTIPRELQIKEGRLYQNPVRELEQYRTGKIQHEGVK
IREKQSLEGIRGRQMDLSVEIQGEEYDKFKIYLAMDEKHHTAVIYDRREGVLTFDRRYCG
DRRDRIHTREMAVEEKDGKLKLRILIDKYSVEIFVNDGEKTMSSLIYTGLGAEGIAFEAR
GEAEISVCQYNMEKSEK

Enzyme Prediction     

No EC number prediction in MGYG000002212_02181.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	36	342	1.6e-98	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1621	SacC	4.00e-146	13	481	10	472	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
TIGR01322	scrB_fam	2.35e-136	21	468	1	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd08996	GH32_FFase	4.21e-130	42	333	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	1.33e-127	36	458	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	2.61e-119	36	342	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM68417.1	2.10e-216	3	492	1	491
QJU15928.1	1.71e-215	3	492	1	491
ASU31066.1	8.02e-214	3	492	1	491
QQQ91597.1	8.02e-214	3	492	1	491
ANU78255.1	8.02e-214	3	492	1	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.04e-97	30	467	24	458	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	7.03e-91	27	468	43	461	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.09e-89	27	468	43	461	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
3PIG_A	7.54e-66	29	479	37	497	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
6NUM_A	8.80e-66	29	479	37	497	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16553	1.08e-89	29	483	21	465	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
F8DVG5	4.14e-89	33	459	30	460	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) OX=555217 GN=sacA PE=3 SV=1
P40714	4.82e-88	33	467	26	449	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P0DJA7	6.37e-88	33	459	30	460	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) OX=264203 GN=sacA PE=1 SV=1
Q05936	8.69e-74	24	492	24	489	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002212_02181.