CAZyme Information: MGYG000002213_01238

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UMGS1872
• CAZyme ID: MGYG000002213_01238
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MGYG000002213_72|CGC1	45024.91	4.4947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002213	2465575	MAG	Spain	Europe

• Gene Location: Start: 3283; End: 4515 Strand: +

Full Sequence      

MNPAYTGKGFLQVTVTTESPVVPLSGARVRISDPADGTVLQELITDSSGQTEPVDLPTPP
LEYSVNDEEKKPYASYAVTVFAEGFKTLHISGVQLLPDGLAVQPAALTPARSGGINVKNL
YIAPHTLWGDFPPKIPEDEVKPLPDPGGLVVLPAPVVPEYIIVHLGKPSDQGVKNEWVLF
RDYIKNVACSEIYATWERETIKANVLAIISFTLNRVYTEWYRGKGYDFTITNSTAYDQSF
VPERTIFESISVIVDDLFNTYITREGAGQPLLTQYCDGRQTQCSGLSQWGSQALGEQGWD
AISILRRYYGSDIYLAPAEKVEGVPMSFGGVTLALGSAGEDVRTIQLQLNRISDNFPALP
KVRADGVYGTETEEAVRTFQRIFHLPQTGEVDFATWYSISNIYVAVAKLA

Enzyme Prediction     

No EC number prediction in MGYG000002213_01238.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	7.09e-13	339	399	2	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	3.53e-08	331	396	37	99	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	2.15e-07	315	401	103	185	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	1.90e-05	285	313	236	265	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
pfam13620	CarboxypepD_reg	5.05e-04	23	107	13	81	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18419.1	1.96e-188	1	410	1	410
QOX64963.1	6.56e-167	8	410	13	416
ASM69598.1	2.17e-146	1	410	9	418
QEI32542.1	2.94e-146	1	410	16	427
QHB25032.1	2.94e-146	1	410	16	427

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002213_01238.