CAZyme Information: MGYG000002216_02347

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000002216_02347
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1386		152803.97	4.153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002216	3003083	MAG	Spain	Europe

• Gene Location: Start: 729; End: 4889 Strand: -

Full Sequence      

MKRNWKKNWWAIGLSASLLLSAVPLCPSTAQASEEGITLEAEDYIRYSGDISVLTNNSNA
SGGKYVGDFDALDCLTYQVEVEKAGNYQVILTVGTIQSQGKVLINSGGSISEEAVVPNTG
NWNMYQDISLSLWLEPGVREITISNMAQTWNLDKLTISYLNSDKIVREQDSYEGVYLDNR
WKNQRIAEQDGTVRYADVGEKIYSGSQAQWNLIPDQEGWYTIQNLSSGRYLVMTEDSQAV
SATEDGNTLDTGKWSVGKVGDYLVLFNKQYSRCGLNLEYQADYPGQVLATEDTLIKWYSA
QWQFHVPASSHQYSIEGTQIKGTTGTAVSTDGTSITVTQQGSARTWTLSEDLSEEPRFVA
DQMPIMEAVYNLTLEESLLNINPGIYGDVFWTGTNWHKVWTRDTAMAVQYSLAWIFPEET
KNSILEKIIGGTTTPQIWEEDTGTGGSYPASIDRIIMEIAGWELYKVTGDKEFLEQIYEV
SKNTLEQDYHVAYDPDSGLFKGETGGLDHRSKTYPDWMDETEQDSIFNIADSKAANANII
FAQALKIMAESAKILGKEEAEIADWEKKAKDLTEAINERLWLEDRGMYASWEYPEYMGSP
VADKVDVIANGYALMFDIADEEQKQAIMEHYPLVVYGADTVWPQKNGRQASTIYHNRGVW
PGWEATMMIGAKENGNLQLAEEILKSCVRGAGMSLTNKEVIDFETGEGLHSDRQLWSIGG
TLAGYYRVLFGMSYTQDGITFSPYAPDWMEGPYSLTNYPYRDAILNLTVNGTGDTLTSIT
VNGEEKPLDYMLPTDASGTYDIVMTVADSGHRSKIHLEEDSWAVCPDLPVLTETADGTLI
WEENPEYTYKLWTGKEYIPVSGGSYRPPRDVYGAYSLVAVDENGISSELSKPILISPEHS
KQTYEAEEGEYNPANFEATAAGFTGTGYVVDFLAKKTDLKLTVEAPATGRYQISLIYNNF
GDATSGQDCGIRSIYVDGTDVGTMVFPIVNFDFQQSPYLFIHLEKGTHTIEIRYNVDDWY
DTNMTTARGTVKNSVCYDSLTLQYLGAEDSLSETIRANLQMLIAQIEGLDSSAYSEESWK
AVSEALHTAKVTVSDPSASQQALTMAINTLVKAFGGLEYGVQKLHLQTALEAAESILSLS
GDYEGEAQSLKAAAEAGNIILADSAASQDQIDQAAYAILDELAKLARKADLVSLESLLEA
SVPLLNQDYTENSLSVLREAIAEAQAVVKNSNRDEDAIPTAYAHLVSAIRNLKRKGNKAA
LESVIAKAKTFLDTKDSYVPSTIEGLDAALRAAEEVYQNDNATQEDVVQAVQRLTQQITE
VRLKGDVNGDGTVETGDATNLLQYAAEINALDPAAFASADVNGDGIADTKDVSLILQFAS
EKIAGF

Enzyme Prediction     

No EC number prediction in MGYG000002216_02347.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM35	904	1018	6.5e-19	0.8991596638655462
CBM6	40	157	7.3e-16	0.855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04086	CBM35_mannanase-like	7.40e-16	903	1017	2	114	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
pfam17389	Bac_rhamnosid6H	2.68e-14	459	626	105	245	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
cd14256	Dockerin_I	5.32e-13	1324	1378	1	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd04080	CBM6_cellulase-like	1.45e-12	37	158	3	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
cd04083	CBM35_Lmo2446-like	2.39e-12	903	1018	2	114	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEH83785.1	3.25e-206	346	1046	62	767
QUT75824.1	2.87e-139	162	1028	20	871
QEC45824.1	3.39e-122	182	1028	17	871
AFG37033.1	1.51e-109	348	1014	86	758
QNF32001.1	1.29e-107	339	1012	203	862

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WNL_A	5.37e-06	904	1014	387	494	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNM_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNK_A	5.40e-06	904	1014	406	513	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNP_A	7.05e-06	904	1014	387	494	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNP_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55296	1.69e-08	893	1019	13	129	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55297	1.30e-06	901	1019	21	130	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P26831	2.43e-06	1134	1337	1368	1590	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
P55298	2.96e-06	901	1012	20	124	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000404	0.998425	0.000583	0.000231	0.000176	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002216_02347.