CAZyme Information: MGYG000002218_01609

Basic Information

• Species: Parabacteroides sp000436495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp000436495
• CAZyme ID: MGYG000002218_01609
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	MGYG000002218_12|CGC3	78304.92	4.9608

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002218	3613635	MAG	Spain	Europe

• Gene Location: Start: 76502; End: 78541 Strand: +

Full Sequence      

MKRRIALWAASLAVFACSSVRAEEAGFSGNYQNNRQPLLQKEYIELPLGTIRAKGWMEDQ
LLRMKKGMTGHLDQVYEQVMGQRNGWLGGDGDVWERGPYWIDGLLPLAYILDDEELKKKV
QPWIEWSLASQKENGYFGPDTDRPYEPGLQRDNAYDWWPKMVMLKIMQQYYSATGDERVI
QLLTNYFKYQLKTLPESPLGHWTFWGEQRGGDNLMVVYWLYNITGDKFLLELGELIHKQT
FNWTDVFLHQDHLSRQLSLHCVNLGQGFKEPVVYYQQNKDPQQIMAVKKAVKQIRNTIGL
PTGLWGGDELLRFGKPTAGSELCTAVEMMFSLEEMLEITGDVEWADYLERITYNVLPTQI
TDDYSARQYYQQFNQVNVTRDYREFSTPHEDTDILFGVLTGYPCCTSNLHQGWPKFVQNL
WYATADNGIAALVYGPSEVMAKVAEGVGVKIQEETAYPFDEAIQFRVSFTDKSVKEAFFP
FHFRVPSWCQQPVVKLNGKAIEVDLFPGEVARVNRTWKEGDCLTLELPMDVTVSRWYDGG
AVVERGPLLYALKMQEKWEKKSFEADKVVTYGPWYYEVTSDTPWNYALSESSFAPERIQQ
SFIVEKRPSVTGYPWNVENAPISIKTQAKRVKNWTLVRGSAGPVAYYTQMENDTEGEETI
ELIPYGCTTLRIAEFPVRR

Enzyme Prediction     

No EC number prediction in MGYG000002218_01609.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	317	551	7.5e-34	0.4312977099236641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.78e-62	84	551	51	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	6.51e-30	113	552	84	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP55412.1	1.54e-148	31	677	28	650
ALL07583.1	3.26e-147	28	677	25	650
QNK64903.1	2.07e-144	12	677	3	644
QES88795.1	3.03e-143	29	676	27	650
ACU60445.1	6.33e-143	34	677	31	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	1.89e-20	171	556	252	612	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	2.97e-20	41	553	24	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.56e-18	41	553	24	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	3.10e-10	90	590	69	580	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
6YQH_AAA	4.59e-10	223	535	229	542	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.70e-08	317	550	334	565	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000530	0.622987	0.375649	0.000301	0.000276	0.000230

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002218_01609.