CAZyme Information: MGYG000002218_02911

Basic Information

• Species: Parabacteroides sp000436495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp000436495
• CAZyme ID: MGYG000002218_02911
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334		39374.82	7.1715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002218	3613635	MAG	Spain	Europe

• Gene Location: Start: 3138; End: 4142 Strand: -

Full Sequence      

MIKYRNQMNIPLFCYKEKGKLFLFLYFVSIWYSRFVNRFIKSKIMKNRRLVLCMSVKTGI
ACLLASIYTSCSVKTDSAFPAPVAPMGTEHWTYNEEISDEFEGTSLDTAKWFDHNPTWIG
RQPSLFRRENVRVENGQLILSGKREQVPNAPEGYHTFTSAAVQSKKKVLYGFFEIKCKPM
NSALSSAFWLYVQDSIKQEEIDIFEICGRHDSLPNYPKTYFATSHYIIKTHDLQISDHVE
FMSEIPWAERSFVAGLKWTRDELVWYVDGKEIRRRKNDFWHSPETINFDSEAFPSWWGLP
SDTDNGGEFQIEYFRYWSEDKPEKEHSIFMNDMK

Enzyme Prediction     

No EC number prediction in MGYG000002218_02911.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	98	317	1.1e-79	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02178	GH16_beta_agarase	1.80e-57	77	317	6	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd00413	Glyco_hydrolase_16	6.61e-28	99	317	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	4.78e-24	98	317	2	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02177	GH16_kappa_carrageenase	1.84e-16	89	317	6	268	Kappa-carrageenase, member of glycosyl hydrolase family 16. Kappa-carrageenase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of kappa-carrageenans, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Carrageenans are linear chains of galactose units linked by alternating D-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Depending on the position and number of sulfate ester modifications they are subdivided into kappa-, iota-, and lambda-carrageenases, kappa being modified once. Carrageenans form thermo-reversible gels widely used for industrial applications. Kappa-carrageenases exist in bacteria belonging to at least three phylogenetically distant branches, including pseudoalteromonas, planctomycetes, and baceroidetes. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
pfam00722	Glyco_hydro_16	1.27e-10	126	278	1	131	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23370.1	2.22e-149	76	334	27	284
CDN31368.1	9.87e-127	60	318	6	262
QZT35647.1	1.71e-89	82	317	24	260
QZE15408.1	4.65e-87	81	317	24	261
ADE53088.1	8.75e-68	66	317	3	251

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ATE_A	6.62e-21	84	294	11	226	Highresolution crystal structure of beta-porphyranase A from Zobellia galactanivorans [Zobellia galactanivorans]
3ILF_A	6.00e-19	84	294	13	228	Crystalstructure of porphyranase A (PorA) in complex with neo-porphyrotetraose [Zobellia galactanivorans]
3JUU_A	5.92e-17	89	270	25	221	Crystalstructure of porphyranase B (PorB) from Zobellia galactanivorans [Zobellia galactanivorans],3JUU_B Crystal structure of porphyranase B (PorB) from Zobellia galactanivorans [Zobellia galactanivorans]
5OCR_A	3.04e-16	89	286	19	235	Crystalstructure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_B Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_C Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_D Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans]
4AWD_A	4.61e-16	82	270	40	260	ChainA, BETA-PORPHYRANASE [Phocaeicola plebeius],4AWD_B Chain B, BETA-PORPHYRANASE [Phocaeicola plebeius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7GXG2	7.44e-23	68	223	26	188	Beta-porphyranase D OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porD PE=3 SV=1
D7GXG0	3.30e-19	84	294	22	237	Beta-porphyranase A OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porA PE=1 SV=1
D7GXG3	2.84e-18	91	270	29	216	Beta-porphyranase E OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porE PE=3 SV=1
D7GXF9	3.84e-16	89	270	38	234	Beta-porphyranase B OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porB PE=1 SV=1
B5CY92	2.45e-15	82	270	37	257	Beta-porphyranase B OS=Phocaeicola plebeius (strain DSM 17135 / JCM 12973 / M2) OX=484018 GN=BACPLE_01689 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999756	0.000251	0.000000	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
21	40