CAZyme Information: MGYG000002219_00225

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000002219_00225
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		52506.87	7.857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002219	2429287	MAG	Peru	South America

• Gene Location: Start: 2095; End: 3537 Strand: -

Full Sequence      

MTTNRREFLKGMALSAGAGMAAGCVCAKGAVGGAPGAPMRNFRCAPMKSGIRVGVVGVGS
RGYAAAMRLLQVPGVSVTAVCDIRAEYADKAAKAVHGKSGAKPLVFSGTAEAYKGLCDSG
RVDVVYNATSWDAHVPIAVYAMKAGRHAFIEVPSAMFVDECWELVETAEKCRVHCMQLEN
CCYGEEELLALNLCRLGMLGELIHGEGAYIHDRRWQIFNDSQWERWRNRWNEKHAGNYYS
THGLGPICLDMGINRGDRLDYLVSVDSHQAGYEAFARATLAADNPLRGERFAMADMNVTT
IRTAKGRTIMLQHDVSSPRPYSRLNLIAGTKGVFRGYPRLEIYLEGGDEWPRSGGHHAFS
EEATARIRAAYAHPLVKQVGDIAKKVGGHGGMDYMMDLRWAYCLQRGLPLDTDVYDLASW
CAVSELTERSARSRARTMDVPDFTRGAWKTPCNSNLMDATIEVSAFGVGDVRQADGQLSV

Enzyme Prediction     

No EC number prediction in MGYG000002219_00225.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	49	450	8.7e-153	0.9874686716791979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.42e-14	63	373	19	300	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	9.56e-09	63	174	15	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	0.006	114	254	57	187	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIM37953.1	5.39e-135	45	449	52	447
QQD11965.1	1.40e-132	45	456	52	454
QLE88973.1	5.93e-132	4	450	5	448
QLE81030.1	5.93e-132	4	450	5	448
AVR47122.1	6.39e-132	3	472	5	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.83e-100	39	450	32	440	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	7.79e-65	51	454	21	437	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3KUX_A	5.75e-06	56	253	8	189	Structureof the YPO2259 putative oxidoreductase from Yersinia pestis [Yersinia pestis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0HTG8	2.32e-124	4	450	5	448	Glycosyl hydrolase family 109 protein 2 OS=Shewanella sp. (strain MR-7) OX=60481 GN=Shewmr7_2602 PE=3 SV=1
A0KYQ9	6.58e-124	4	450	5	448	Glycosyl hydrolase family 109 protein 2 OS=Shewanella sp. (strain ANA-3) OX=94122 GN=Shewana3_2701 PE=3 SV=1
Q0HH61	9.30e-124	4	450	5	448	Glycosyl hydrolase family 109 protein 2 OS=Shewanella sp. (strain MR-4) OX=60480 GN=Shewmr4_2535 PE=3 SV=1
A8H2K3	1.86e-123	1	450	1	447	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1
B1KNF7	2.71e-120	46	450	52	458	Glycosyl hydrolase family 109 protein OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=Swoo_1749 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TATLIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000013	0.000005	0.000242	0.333589	0.666152	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002219_00225.