CAZyme Information: MGYG000002219_00838

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000002219_00838
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792		88038.74	7.7649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002219	2429287	MAG	Peru	South America

• Gene Location: Start: 94; End: 2472 Strand: -

Full Sequence      

MTVWKCAAIASLGLVGIAHSAQVIDMNDEWVRVAGARTQTVDLPDDFRINLPWTQEGSRN
RGFKPETNVVYRKTFSADESWRGRRVSVEIDGAQDVCDVSLNGRRVGAWEYGSLGFEIDL
SSALSYGADNTIEVRCANGGRHSSRWYTGCGITRGVRMVVRDQIAFRRHGVSVTTPVVDA
NRAVVKVVADLIGWSGVSNEVATVSAEVFAPDGRSLGKVRQEVGYVKGSFAEVSLPELVV
EKPELWGLESPRLYRVVASVSHKGKVTDSEERRFGIRQIAFGKDFGFRLNGEKAFLKGMS
NHQHLGALGEASHPRAWKRQLKLMKEFGFNAIRCAHNPYPEELLDLCDEMGILVVDELVD
KWRTCWAGRKPFIELAPLLVQEWVRRGRNHPSVILWSVGNETQHVEYCLPFGDGGHGITE
YRFLDALVKRWDSTRPTTVAMFPARAGGIMSRDPGFRENPIPPELSCVTEVASYNYLPGD
YAAYRKFNPNLILFQSEAAVNDMACPFYLMDRESMVGVSYWGAIEYWGESDGWPKKGWNY
SFFRRTLEPLPQAWLIRSAFRTVEEEPIVRIGVKVGVTEHVRWNDVTVGSMRLASKWCPT
NTGHSCVYVFSNGDAVELRLNGRSLGVKENNVGSIGKRNIFSWDKVPSEPGEIEAVATCS
GNVVARHRLETAGPAVGFKLVAENAEDWRADGRDLQYVWVTAVDAQGRRVDDVSANVNLS
VSGSARLKAVDDGDSYTDAIFATSRARFHVGSILAIVQATSEPGEAVLTVSSKRLGEKSI
RLKSRAMSVDRW

Enzyme Prediction     

No EC number prediction in MGYG000002219_00838.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	564	9.6e-94	0.6183510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.37e-54	20	404	9	409	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	7.52e-35	18	436	47	484	beta-galactosidase.
PRK10150	PRK10150	3.05e-34	68	439	66	447	beta-D-glucuronidase; Provisional
PRK10340	ebgA	9.27e-32	39	435	89	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam18565	Glyco_hydro2_C5	1.23e-23	679	781	2	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT42015.1	1.07e-236	25	783	42	802
QQA07705.1	1.07e-236	25	783	42	802
BCA48695.1	1.07e-236	25	783	42	802
QNH64155.1	1.26e-236	16	783	46	807
QUT69831.1	1.21e-235	22	783	39	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	2.20e-85	41	782	37	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	2.44e-85	41	786	36	803	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
7RSK_A	3.25e-85	41	785	37	778	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	5.23e-84	18	775	19	811	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	5.69e-83	24	779	10	802	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.02e-87	39	787	72	851	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	2.76e-57	39	780	76	815	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	3.70e-33	21	790	45	799	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
Q47077	4.88e-32	60	436	112	485	Beta-galactosidase OS=Enterobacter cloacae OX=550 GN=lacZ PE=3 SV=1
T2KPJ7	1.07e-31	49	442	82	471	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000356	0.998932	0.000205	0.000175	0.000166	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002219_00838.