CAZyme Information: MGYG000002219_01168

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000002219_01168
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743		81956.66	6.7648

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002219	2429287	MAG	Peru	South America

• Gene Location: Start: 715; End: 2946 Strand: -

Full Sequence      

MSCAALFLAVAEWIAGSYVLPVGDAAFFEDAPNDIVIRKFTAKAGVRKAEWRVAAPGMRD
LFVNGTRVTSTALSPLTPFRKRILEESFDVTSLVNAQGENELRVELGNGWWNLLPLKMWH
RRNLRDAMAQGIPCVRATLDITYEDGSRQQVETDGEWDAAEGRLLMNSIYLGVKEDARWV
VHANGKARVVKGPDGKVVQAGDFPKTVVIGRWKAKSVSRIPGKEGTWLIDMGANRAGTYR
VRMRTVPTGTVVKFRLGELMNVDGTVNTMTAVAGQIKDPKKGPLFGVAEQCDTWISGGAA
DATFEPRMTFHCFRYIQVEGLPYMPTPEDFEMLAWSADLKEGGRFNCSNEKLNLLHEVCR
RTFRANLQSVQSDCPGREKFGYGGDLACTAESFRCNWAMLPFYRKTLRDFLDEAADDGLF
TETAPYVGIGSNPVISKNETGGRAVAPMGWAIGVPVLLDVMIRYDGDLESLKVAYPALVR
FIRIVSERYPHDDIPPCLGDWIAVEKADPGLTCLAHWHEFLSKTAKFAGLLGRVDDAAAF
RAHADRVAAKFRAKYVKSGGLVNSGLQGEQLFALYNGLLDKRDVPGAYDILKRNIASHGD
ALTTGIFATQYLFEYLSAHGDADLAGRVATHEGAPGYYFMLDRGATTLWEDWFEALCHNA
YSNCHPMFGSVEQWFTRHVLGIAVCDDAVGCDKVRIVPHAVAGVTSASGWLDTPKGRIEV
SWRMEGGKMVIDKRIPDGIVEAP

Enzyme Prediction     

No EC number prediction in MGYG000002219_01168.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	223	738	7.5e-117	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.79e-63	340	679	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.12e-26	46	178	3	131	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.27e-21	223	331	4	97	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.67e-06	687	736	5	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF16684.1	3.88e-150	11	736	142	859
ANH82563.1	5.29e-147	11	742	140	866
QTN34257.1	4.49e-140	11	743	167	904
QDV80219.1	1.50e-138	11	739	141	865
QDV75585.1	2.10e-138	11	739	141	865

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.93e-71	38	723	181	876	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.14e-60	11	736	285	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.04e-34	38	726	136	820	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.82e-60	11	736	285	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.50e-52	39	736	190	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	8.61e-51	12	736	148	869	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.26e-41	39	739	176	872	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.712589	0.283199	0.003370	0.000246	0.000224	0.000382

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002219_01168.