CAZyme Information: MGYG000002219_01325

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000002219_01325
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611		67908.41	6.6767

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002219	2429287	MAG	Peru	South America

• Gene Location: Start: 139; End: 1974 Strand: -

Full Sequence      

MKSLKVVLLMALGLAYGEACAAAFESVLEKTIVGDVRVTADEAGGWSFACARRSLGVGVD
EIEVSLSSEAEAPPPPFKVSWTIPQCDMQAFWTPQDDASYPIPPDWGGTKSSDFAHWSPI
GAIVNDRNRSRLVFAADEAHRVVRYAAGLNEGACAMRCWMSFLSGVEAPLKSYAVRIRLD
RRDVFWSDAIREAAEWISSRPGNEPCAAPAAAFKPLYSTWYGFHQNVFAREIEEECAIAA
RLGMKTLILDDGWQSDGIHQGYSFCGDWQISSRRFPDMAAHVRRVQEMGIRYMVWFSVPF
VGTKSANYARFKGKYLYECLGAGVLDPRFPECRAFLVGTYEKALRDWNIDGFKLDFIDNF
RISGTDPAVAENYAGRDTKSVEEASGRLMGEVMARLKAIKPDLLVEFRQAYVGPAILRYG
NMLRVADCPGDKNRNRRGIARLRLTSGKGAVHGDMLEWHPDEPAEVAARAILDSIFGVVQ
YSMVLCRLPERHVEMVRHWIDFSTRHEEALLHGKFRAYNPEHGYPVLAGESADERVLGVY
LSGFSVDCGDADRTTYVLNGTGADRVLLHLRVTPRTVQAFDTFGRAAKAPKLAAGVCEVE
VPCAGYLRISY

Enzyme Prediction     

No EC number prediction in MGYG000002219_01325.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	188	519	3.2e-33	0.48401162790697677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.55e-57	215	502	4	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	2.44e-15	214	356	2	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	1.77e-09	239	513	67	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06591	GH31_xylosidase_XylS	4.19e-08	215	355	4	153	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	2.99e-07	266	413	311	468	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	3.28e-183	32	611	6	587
QTH41069.1	1.38e-145	77	610	52	589
AIQ18885.1	2.19e-141	78	609	52	589
QHW35515.1	4.62e-140	78	605	52	580
QGQ97599.1	4.85e-136	77	605	51	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNR_A	3.26e-06	216	523	332	646	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16551	7.73e-06	209	355	287	441	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003184	0.904041	0.091844	0.000324	0.000285	0.000289

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002219_01325.