CAZyme Information: MGYG000002220_00139

Basic Information

• Species: UBA3375 sp900551955
• Lineage: Bacteria; Firmicutes; Bacilli; Mycoplasmatales; UBA3375; UBA3375; UBA3375 sp900551955
• CAZyme ID: MGYG000002220_00139
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A/1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
868	MGYG000002220_5|CGC1	95959.16	5.1525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002220	735168	MAG	Peru	South America

• Gene Location: Start: 1215; End: 3821 Strand: -

Full Sequence      

MASKQRRSQSNNKTAKNNKKRKGFLGFMNKGKVWQRIVKWFLLVLFIFALFGSIVVGAVV
AKYKKDLAPVNHNTFYTAKASTNVFDRKGEYVGSLSLNNIRWIDLKDKDGNLAVSDKYLE
GIIATEDKNFLNHGGVDYGGMVKATVSTVFSSNDRGGSSITMQLAKILYMQDWITPNEEG
VDRRSEDKVGYKVTQMLYAHEIEGQFNKGQILENYVNVVGFGNAGYGIVKAANYFYGKAP
NQLDLNEAATLAGMSQLPAVYNPYDNPDATTERRNIVIDRMVAEKYITKEEGEVTKALPI
NNTLVDPGSRPISNQEKVQGYLDVVYREFLEIIDPNKSGEFDVNTAGMNIYTNMDVGLQI
GLYDILNSNNPNLFEDELIQTGVVLMDSNNGEVLAIGNGRNEHKGFLGTNFAYNYNRQPG
STAKPIVDAGPAIEYLDWSSAHPLEDKSITYDGGPEVHNADGKYLGWLTLGESLGKSRNT
TALETFKQVSAAKGIDSIYNFVTGLGFDQINKDDFNQAYAIGGWQYGTTPYQLAGAYAAF
GNGGVYNTPHTVNHIDIQPESIYYEKLGANVTPQVESKRVMKESTSYIMSQMLKSDQPYA
KGYAPYSPAMPSLSVKTGTSDWGDSGAQYKIPKAAQRDKWVAGFNNNIALVTWTGYTQEH
EKTGHFIQFNSEYEKNCYKAIVEMVAKTADKDILSNGALQKPENVIEKEAHVSEGKIVAG
GSPNYFIKDSEDDNGLHPADDAKTPTDLSISVDATNKKLSISWNYPEENKDGLEYIIYVD
GKEVKRTTDLKVELTYDELVASGGCKSSYEITVGASRKTKDKDGNEQENVSPPTASRTVD
FGSDEFCKTPATKPPTDEEKQENGKNDN

Enzyme Prediction     

No EC number prediction in MGYG000002220_00139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	114	282	8.5e-48	0.8813559322033898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	9.61e-119	31	662	4	577	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.10e-73	34	756	1	790	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	8.64e-57	81	655	36	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	6.17e-54	89	282	2	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02071	PBP_1b	4.40e-50	119	661	160	662	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG61477.1	1.10e-113	6	777	12	729
AGX05254.1	2.79e-107	37	812	31	766
APH04640.1	1.48e-106	30	811	28	749
QOR68963.1	3.65e-105	65	777	13	685
ART76829.1	5.11e-105	61	783	58	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	6.90e-66	84	734	10	618	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	2.51e-60	84	734	19	627	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	5.80e-53	201	671	2	445	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	2.08e-50	201	671	2	445	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2V2F_F	2.77e-41	321	657	8	337	Crystalstructure of PBP1a from drug-resistant strain 5204 from Streptococcus pneumoniae [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	6.36e-91	3	765	7	729	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q8DR59	4.60e-75	28	657	1	600	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
Q04707	4.60e-75	28	657	1	600	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q00573	1.09e-73	28	657	1	601	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
P38050	1.38e-54	80	728	47	632	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999910	0.000103	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
37	59