CAZyme Information: MGYG000002221_01108

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1889
• CAZyme ID: MGYG000002221_01108
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		36558.02	4.4514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002221	2286055	MAG	Peru	South America

• Gene Location: Start: 98; End: 1060 Strand: +

Full Sequence      

MSSKSVVLRNSNYPEFCSCHVRDPKVWYENGKYNMVLGARTLDDKGCVLFYTSDDLENWE
YSRCDSVENFGFMWECPDCFQVNGHRYLSVSPQGLEHYETKYQNVFQSGYFHYDNGLTDF
TEWDMGFDFYAPQTFETPDGRRIIIGWFGIGDSAYSNLTVPLGYQHCLTVPREVTADENG
VLMQNPARELAALRMGSRKITDGETAKVQLPTELVSAVCGSFSIVLEDALFLEWDGKTFR
MRFENEKLGGGRTVRNVPLESCYDIRVIIDTSSVEVYLDSGRKVLGSRFYPEDTQISIRA
EGIFPELFTLKGMEAEYLGE

Enzyme Prediction     

No EC number prediction in MGYG000002221_01108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	4	186	2.5e-46	0.6143344709897611

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.19e-88	3	175	106	286	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	3.86e-74	6	291	134	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	4.43e-66	20	312	161	482	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	3.09e-58	12	186	122	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	3.75e-54	20	281	133	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM70237.1	8.23e-115	1	320	127	442
CCO04388.1	1.70e-114	1	310	140	456
BCN29305.1	5.38e-81	2	314	150	475
CBL20909.1	2.02e-80	3	303	151	460
QCU01937.1	2.25e-79	3	301	151	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	2.54e-36	20	317	159	482	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
3PIG_A	1.81e-27	20	299	178	494	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
7BWC_A	6.72e-27	18	292	176	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
7BWB_A	6.72e-27	18	292	176	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
6NU7_A	3.91e-25	14	298	158	470	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	4.64e-52	4	291	146	454	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	2.13e-44	20	299	166	472	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P16553	2.19e-44	20	300	157	460	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P40714	2.23e-44	20	300	158	461	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
Q56660	2.44e-44	14	317	220	540	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae OX=666 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002221_01108.