CAZyme Information: MGYG000002221_01761

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1889
• CAZyme ID: MGYG000002221_01761
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		37127.39	5.2363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002221	2286055	MAG	Peru	South America

• Gene Location: Start: 498; End: 1466 Strand: +

Full Sequence      

MSDKIFTPVNPNAQDCVKNVMKYLSDITYKQIITGQHTQTMAQEELSHIEKVTGKLPALV
GFELLSYSPNINYFDTDDECMKEVTENYGTLKKAWEWAEKKGLITFTWHWFSPLGGRSKA
FFTDNTDFDAAKAVIDGTAENIALISDMDMMAGLLRPFCDKHIPILWRPFHEGDGNWFWW
GAKGAEPLKKLWKIMYDRFTNIHKLNNLIWVWNAPTPECYPGDDTVDIISRDMYPPEHEH
TSQSEMYYDLMKITKQSKITIIGETGTLPSAKAIAEERVGWVSYMTWSQVFCLTEKFNTN
DALKEMYSSPYSVTKDKLPVLY

Enzyme Prediction     

No EC number prediction in MGYG000002221_01761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	9	316	9.8e-97	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.39e-50	9	316	1	310	Glycosyl hydrolase family 26.
COG4124	ManB2	3.54e-14	163	234	180	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL34621.1	9.75e-196	1	322	1	322
CBK96616.1	3.97e-195	1	322	1	322
QTE69139.1	3.78e-165	7	322	6	321
ADU22555.1	3.71e-156	1	322	1	322
AZK45707.1	5.83e-148	7	322	5	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	6.13e-68	7	320	5	312	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	3.29e-62	10	318	147	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	2.93e-57	7	319	33	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	4.19e-41	8	318	23	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	8.98e-41	18	287	55	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	7.79e-66	10	318	176	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	1.37e-54	8	318	28	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	1.77e-53	27	308	41	323	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P49425	1.96e-53	30	319	168	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55298	9.64e-48	7	319	155	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002221_01761.