CAZyme Information: MGYG000002223_01531

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000002223_01531
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		38065.18	7.3199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002223	1981557	MAG	Peru	South America

• Gene Location: Start: 1916; End: 2929 Strand: -

Full Sequence      

MGTTQGEEEQFDTVHSYFALRKWSCAPDARGVLRFCLNDKPILLNGLLDQGYWPEGLYTP
PSDAAVERELSEVKALGYNLLRKHAKLEPQRWYYHCDKLGLVVWQDMVNGGSKYNLWFVT
YLTNVLQPLVRRLPDKAPLWGLLSRGSESSRTEYRRELADTVQALRCHPCVGCWVPFNEG
WGQYDAAGAVQAIRALDDTRLVDEASGWYDQGGGDVYSLHNYFYPLRVRPQTRTVALSEY
GGIAWPMPGHEPPRKTYGYGTAKSREELTARYKKMQLGTVLPQLQKGLSALVYTQLTDVE
DEVNGLFTYDRTAIKPDANAVRSVNAALAAEFAKVIK

Enzyme Prediction     

No EC number prediction in MGYG000002223_01531.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.94e-06	34	202	292	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	1.13e-05	35	259	8	231	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB30001.1	1.20e-250	1	337	253	589
CBL01777.1	1.98e-249	1	337	253	589
ATL90007.1	1.12e-213	1	337	255	591
QIA41822.1	3.71e-212	1	337	255	591
ATO99791.1	3.71e-212	1	337	255	591

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.68e-70	12	325	282	579	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002223_01531.