CAZyme Information: MGYG000002224_00816

Basic Information

• Species: Faecalibacterium sp900540455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900540455
• CAZyme ID: MGYG000002224_00816
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000002224_4|CGC1	90947.83	6.0044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002224	2335657	MAG	United States	North America

• Gene Location: Start: 101310; End: 103736 Strand: -

Full Sequence      

MQSQENTTRAQRRRCRQMAQRIMAELCPKTIWMPCGDSPLAQALSAAGAQVAADPQPVQT
QLTVVEDPAWAQVPDALSGPLLLVAADNPLLSSWTDTLAERGYYRDFSWKNRGRTQPAAL
YRQADVRPAPQALAQGYEQELDSVRENLARTQHQLEEQDAQLQRLRSDLSLSRSHEQQLE
NALAQVTGSKFWKITWPARYLVSKTRQVCRTFPPFVFLASLRRLGLAGVRAQMEARREYA
ALFPGKTLRADQFAPVDLLVRQVHNQPRAPKISVIVPMYNPPLEFLQQLLDSVRNQTYQN
WELCLADAGTDEAASRMAAAAAAEDPRILYRKLEKNEGIAGNTNQGFAMASGVFFALLDH
DDLLHPCALWYAARAIAEQGADFVYTDEATFEGKVDNVVLYHFKPDFMVDNLRSNNYICH
LSVFSRALMEAAGGPEREAYNGSQDYDLFLRLTEMARCIVHIPHALYYWRSSPGSTAADI
SAKTYCIDAGIAALRSHYQRLGVAVEDVSLIPETPGYYKTDYVIDRPGRVSILIPTCDHA
QDLETCVESIYARTTYPDFEVLLIENNSKEEATFQTYARLQKRHPENLRVLTWQGKGFNY
SALNNFGAQYATGEYLLLLNNDTEVLTPRWLEEMVMYAQQKRVGCVGAKLLYPDDTVQHA
GVGLGIGGVAGHLHKYFPAASDGYMGRLNYVQDVYAVTAACLLVRTEIYQAVGGLDESFA
VAFNDVDFCVRVREAGYTNVFTPFAQLYHYESKSRGQEDDPVKQRRFQGEVLRFQQRWGK
QLAAGDPCTNPNFDIQREDFSLKILPLE

Enzyme Prediction     

No EC number prediction in MGYG000002224_00816.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	273	395	1.8e-24	0.7176470588235294
GT2	531	710	1e-20	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	7.57e-79	270	470	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.04e-42	532	751	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.10e-34	529	757	4	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	5.11e-22	273	470	1	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.51e-21	274	461	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA81613.1	0.0	14	808	15	808
ATO99477.1	0.0	8	808	9	809
QIA42131.1	0.0	8	808	9	809
ATL89683.1	0.0	8	808	9	809
CBK99960.1	0.0	15	808	16	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	9.12e-10	272	382	7	115	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.98e-135	259	802	358	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.38e-85	268	806	317	844	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	4.91e-11	270	622	13	379	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
A0A0H2UR96	1.18e-10	272	412	5	144	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
A0A0H2URH7	2.74e-08	271	415	6	147	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002224_00816.