CAZyme Information: MGYG000002224_00910

Basic Information

• Species: Faecalibacterium sp900540455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900540455
• CAZyme ID: MGYG000002224_00910
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MGYG000002224_5|CGC2	33641.9	5.2101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002224	2335657	MAG	United States	North America

• Gene Location: Start: 30669; End: 31613 Strand: -

Full Sequence      

MLTITVAQDGSGDFSTISEAVLAAPYDLETLVLVGPGEYREKLVCEKRCITLRGAGAEAT
RLVWADGGKLPHPDGRPTHTFRSYTAFFSGEMVTVEDMTIENAAGPGSEAGQAIAAYVDS
QRAVFRRVRLLGNQDTLFCAPLPQAEREKDGFLGPRKLAPRRPSAQYYQGCEIAGDIDFI
FGGADALFEQCTLRTVDNHLAHSYVTAPSGPADGLGFVFWDCDFVSICPAGTVYLGRPWR
PTGRTAVLDCRLGGHIAPEGFSGWNDRPDLAQAGFAESGSTGPGAGERPSWVKVPDAEQA
AALLSAARKRCRPV

Enzyme Prediction     

No EC number prediction in MGYG000002224_00910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	302	3.6e-76	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	2.29e-52	4	291	2	274	Pectinesterase.
COG4677	PemB	3.92e-52	6	299	87	392	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	6.35e-44	4	305	7	292	pectinesterase
PLN02432	PLN02432	8.93e-42	2	305	11	282	putative pectinesterase
PLN02745	PLN02745	3.20e-40	4	300	287	570	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA44050.1	8.06e-193	1	313	1	313
ATP00222.1	8.06e-193	1	313	1	313
AXB27671.1	5.70e-188	1	312	1	312
CBL01447.1	5.70e-188	1	312	1	312
AXA81880.1	3.19e-186	1	313	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	6.88e-32	6	291	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	9.72e-25	4	285	9	273	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	1.44e-18	6	285	35	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.43e-15	7	256	12	276	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	4.94e-12	7	256	12	276	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	9.37e-34	4	293	7	280	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	8.87e-32	3	305	84	371	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q43062	6.73e-31	6	291	211	482	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q96576	2.06e-30	6	291	235	504	Pectinesterase 3 OS=Solanum lycopersicum OX=4081 GN=PME3 PE=3 SV=1
Q9LXD9	2.16e-30	4	296	241	529	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002224_00910.