CAZyme Information: MGYG000002224_02066

Basic Information

• Species: Faecalibacterium sp900540455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900540455
• CAZyme ID: MGYG000002224_02066
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	MGYG000002224_25|CGC1	69713.38	6.8097

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002224	2335657	MAG	United States	North America

• Gene Location: Start: 15882; End: 17765 Strand: +

Full Sequence      

MRRVKDLAGYAVQLTRDEGLGTMLVRGAGFVRRRFFGKRARYLPTKKVLQAQRAECAAAP
GGLPSISILTPLYNTPEKYLREFLDSFVNQTAPNGQLVLADASDPDHAEVGAIVREYQAK
NQRIVYKKIENQGIAANTNAAAALAEGDYLALADHDDILAPHAMYTMGKAILQLRQQGLA
DDFLYSDEALFEKSIRRPRAAHFKPDYAPDYLLCCNYICHLAVFRRSLYQELGGERPECD
GSQDHDLFLRLAQRTGGAAHVPQVLYYWRVHAGSTSGGAEAKPYVANGAKKALADHLART
GGRGTVEDGLYPSTYRVKWEIQGSPKVSILIPNKDHTAELEQCLHSLWTKTQWEHFQVIV
IENNSTDPETFAYYKKAQDRYDGLQVVQWPGQGFNFSAINNYGRQSADGEYLLLLNNDVE
VINGDWLTELLRQCARPDGAAAAGAMLYYPDDTIQHAGVITGLGGYAGHSHKYKRRGSGG
YMFRAGTVQDLSAVTGACLLVRADVWDALGGLDEAFAVAFNDVDFCLRVRDSGERIIWTP
YAQLYHHESKSRGDDEKDPVKAARFAAEQQRLYALHGGKQGLLADPYYNPNLTHDREDFS
ESDDLRGLKQGRVEVFPPPASQKREAL

Enzyme Prediction     

No EC number prediction in MGYG000002224_02066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	67	232	3.5e-19	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.16e-67	64	270	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.08e-37	329	548	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	5.91e-28	325	554	3	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	1.33e-18	67	276	1	201	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04196	GT_2_like_d	1.92e-14	67	277	1	211	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27819.1	0.0	1	615	5	621
CBL01588.1	0.0	1	615	5	621
CBK99650.1	0.0	1	615	5	621
AXA82332.1	0.0	1	615	5	621
ATL90529.1	0.0	1	615	5	621

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	7.36e-118	64	599	366	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.24e-91	55	593	310	832	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	2.01e-13	64	185	8	129	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
A0A0H2UR96	2.14e-07	66	189	5	126	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P9WMY2	7.06e-07	340	573	18	257	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002224_02066.