CAZyme Information: MGYG000002225_01650

Basic Information

• Species: CAG-873 sp900554265
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900554265
• CAZyme ID: MGYG000002225_01650
• CAZy Family: GH27
• CAZyme Description: Isomalto-dextranase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474		52773.11	4.6741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002225	2013827	MAG	United States	North America

• Gene Location: Start: 51; End: 1475 Strand: -

Full Sequence      

MRYYIKALAAAVMLSSAASACNDEIEMRRPPVFELPDLPEVTDIHTFKAPLYWSIYEYCL
ELEHAGVSNSDMDYTPAQWQETIDWIASDLKPYGYDMVCTDGFIPMLAQDQSGYMTHYGS
TSIAELVAMAKAKGLRVGIYDNPLWIHGDGSTKIEGTDYTFASLTYNGTEAVTNEGSGDN
WFTWVVATHPGAREYIDGFFKHYHDLGVDFIRMDFLSWYEDGKDRYMGITGRGYGREAYA
RAMCYIAESAKKYGIFTSLVMPHMFNDAEVEARYGNMTRIVADTGNGGWWHCSAQDRGKS
YANWPNCMNMFDGFTYWSHIAGRDKIILDGDFIRLNKFESDAERQTVVSLQLMAGGPVAV
ADQPSTIGANTGFFTNAELLALNADRFVGKPLSDKLNDSNNQIWYGQMTDGSYVVGFFNR
NDGDATLSVNLADLGISGSWNARDLWKHADEGSVSGTLSANLAAHGCKIVKLTK

Enzyme Prediction     

No EC number prediction in MGYG000002225_01650.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	195	451	2.3e-33	0.9388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17801	Melibiase_C	2.54e-18	398	472	1	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
PLN02808	PLN02808	4.76e-12	359	473	261	384	alpha-galactosidase
PLN02229	PLN02229	9.48e-09	375	473	315	418	alpha-galactosidase
cd14792	GH27	1.34e-05	81	385	22	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
PLN02899	PLN02899	1.44e-05	390	473	539	631	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67171.1	2.01e-234	11	472	10	473
VEH14482.1	1.66e-192	45	474	41	468
QUT44530.1	2.28e-192	18	474	19	492
QUT79686.1	2.28e-192	18	474	19	492
QRM98947.1	4.59e-192	34	474	40	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AWO_A	8.69e-90	50	473	38	466	Arthrobacterglobiformis T6 isomalto-dextranse [Arthrobacter globiformis],5AWP_A Arthrobacter globiformis T6 isomalto-dextranase complexed with isomaltose [Arthrobacter globiformis],5AWQ_A Arthrobacter globiformis T6 isomalto-dextranse complexed with panose [Arthrobacter globiformis]
4NX0_A	1.18e-10	191	473	174	441	Crystalstructure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_B Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_C Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_D Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_E Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_F Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_G Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_H Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44052	6.63e-90	8	473	18	492	Isomalto-dextranase OS=Arthrobacter globiformis OX=1665 GN=imd PE=1 SV=1
P14749	2.46e-10	343	473	276	408	Alpha-galactosidase OS=Cyamopsis tetragonoloba OX=3832 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000635	0.159366	0.839716	0.000089	0.000103	0.000090

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002225_01650.