CAZyme Information: MGYG000002227_01378

Basic Information

• Species: Eubacterium_R sp900546785
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900546785
• CAZyme ID: MGYG000002227_01378
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		89083.36	6.1819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002227	2038651	MAG	United States	North America

• Gene Location: Start: 28287; End: 30626 Strand: -

Full Sequence      

MFKLKSKKLEREFNVTDGYLYASQITNTYSGMVFIPDGSGSEFEIRFTDGDTLSSKNLAV
SEAVEKDGKLFFRFKEEMNTTVTMSYRIGSDGETLEKQIAIEQSEPKVIDYVMLENIGIV
NSKSSYTANGGKSEIDEFYSNLGQPFYIDSLFFGCVFPGTKNGVFHGRGEVVYFIGKNAT
GKIICPTTVMGAAKSAMMVDLRKAFFEYIDRISVKSDFRVQYNTWYDRMMDIDADNTEAA
FYKVESKLSSNGVAPLDGYVIDDGWNNYKADFWSVNQKRFPNGFLDLSSLTNRLGSSFGL
WLGPRGGYNFNSKFAKRIERGGFGYYNAESNDICVCSKTYLNNLKEFLVKATRENDIAYW
KLDGFALKPCQNQKHDHITGGDHDMYYITELWRRWIKIFKALRDARKSQGKELWINFTCY
VNPSPWWLQYVNSIWLQNSGDIGFAENYARNEQSQADAEMTYRDSVYYDFIVTRGLQFPL
GNIYNHEPIYGREAHLDYTDEEFEKVFFWNACRGSALCELYISPSMMNDEKWRILARVLK
WQRANHHILKNAMLLGGDPAQNNIYCYASWTEDGEGVIALRNPTHEATPLTLTLNKLMGC
PEGLKNARRFNILSRGTVESSDLYNYNDKINLTLAPFEVRIFQFGKTDKRTDSDGDVNDF
TIVFEYDGNNGVICQNDDILIRIDRGIISVNMGTLRLRSENSISDSNHTVTVVREKNKMV
KLYVDSSLDSSAYEEHAKARLSCELTSDAEGFRIINSATNYSDIVELGGILKKSRKRRR

Enzyme Prediction     

No EC number prediction in MGYG000002227_01378.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.47e-11	220	405	4	188	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	9.07e-07	200	304	18	126	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	1.20e-05	198	304	267	377	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	0.003	222	442	5	181	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO70357.1	1.24e-149	9	738	43	809
QUT26415.1	8.56e-148	9	731	43	805
AZU64122.1	2.40e-146	49	707	278	974
ALG48827.1	2.29e-136	131	730	385	992
ATD48595.1	2.29e-136	131	730	385	992

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000012	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002227_01378.