CAZyme Information: MGYG000002230_00157

Basic Information

• Species: Ruminococcus sp900545125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900545125
• CAZyme ID: MGYG000002230_00157
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000002230_5|CGC1	42940.34	5.7212

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002230	2337720	MAG	United States	North America

• Gene Location: Start: 24953; End: 26089 Strand: -

Full Sequence      

MNYISRLDEAVKLYTQEIILSSDPLYPLWNRENIIFRKQPKWNYIDSCMITAVLGLYEYN
GDEKLLDFAVKFISAYIDENGCIPTLNFSDFNLDNINGGKNLLALYRMTGNKKLFNAAHR
LADSLSEHPRLRCGNFWHKAIYPHQIWLDGSYMAFPFMTEYSRLSHDDSMLEDALNQLRI
IRKLMKDKKTGLYYHGYDETRTMIWADRETGLSSEFWLRSMGWLCAALADMCGLLPDNNE
ISAMLSDLLEALASCCTPDGLLLQLPVRSELSQNYPETSGTLLFAYSALKSYRLGKTSPN
IKKAGEKALSAVIENYIILEKGKAPLLKNICLMAGLGNNRNGSAEYYLSEPITENDAKGI
APLIMAYTELMKGDRIND

Enzyme Prediction     

No EC number prediction in MGYG000002230_00157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	37	372	1.4e-88	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.27e-80	42	372	34	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.90e-71	34	372	19	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35233.1	2.59e-111	14	372	13	378
QEN04316.1	8.20e-107	14	369	5	366
ADZ83101.1	3.70e-101	9	372	2	371
QEH68585.1	2.10e-100	9	372	2	371
BCJ92572.1	5.61e-99	14	373	10	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.74e-74	42	369	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.00e-54	41	370	38	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.25e-54	41	370	28	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.46e-09	126	372	143	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.48e-54	41	370	38	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.02e-40	153	369	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.02e-40	153	369	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	7.98e-12	36	314	23	288	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002230_00157.