CAZyme Information: MGYG000002232_01384

Basic Information

• Species: Eubacterium_R sp900539845
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900539845
• CAZyme ID: MGYG000002232_01384
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
691		76793.38	4.2758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002232	2282853	MAG	United States	North America

• Gene Location: Start: 115272; End: 117347 Strand: -

Full Sequence      

MYGYESEKILFAALGAIVCLGIVSAALFAFFTVNRKVSLDEPAKGAMDLGTYGIDFDDKS
GLFSVSKDDVLYLQNAHSEYKLNDSIVRSTDYESFEITRNGNEIAVLMQSSGLPDVMQTF
AVSEDGNYIQTRLSIISDTQISTNYIAPVVTGKKSIQTARQEISAILEIPFDNDGWKEFE
TNKLYKDTVSYEAGVLFNPTGGGIILGSLEHTVWKTAVETKGGLGDIDSLRLYCGAVDPY
SGDVPHGQVSGEKVSSPLMFIGVFDDWQDGMLQFARANTDVQPKRAQVTENVPVGWNSWG
SVQQDLNYETAVNISDYVKDNFQHIWKQGGGAVYINLDSYWDMLSDEELKAFVDHCHENG
QLAGIYSAPYVMWYQPEEMAQHYVPGTNDTVTYQDITLKKPDGTYYGNEVDGCIPLDVTH
PATKQHVKAQFDRFKKAGFDYIKLDFLVHASFEGDFYDESITTGIQAYNSAMEYVNELLG
DKMFINLAMSPIFPYQYANGRRLACDAYYSIDETEYTLNAVTYGFWEQELYDFTDPDHIV
VWGRDGKADAGEARSRATSGVISGTSFLTGDNFVSPAGNAAEAQKRFKSMFSNTDIIRAA
ETGRIFKAQINGNLPRAANVYRLTDGSSEYIAVFNFSSLPSGFKIDLGDDHASYNIRELW
SGEEFTAEESMKVRISGGDAALYEITEQVSE

Enzyme Prediction     

No EC number prediction in MGYG000002232_01384.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	6.83e-19	293	571	3	278	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	6.07e-08	293	555	2	231	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
PRK08415	PRK08415	0.001	415	473	61	116	enoyl-[acyl-carrier-protein] reductase FabI.
pfam17801	Melibiase_C	0.001	622	685	10	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94688.1	9.22e-144	32	687	42	702
QOS78178.1	2.04e-141	50	688	470	1116
QZN74505.1	1.03e-140	50	688	470	1116
ANE45667.1	2.84e-137	31	685	168	824
QLG41544.1	2.51e-136	50	688	470	1117

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
9	31