CAZyme Information: MGYG000002233_02027

Basic Information

• Species: Acutalibacter sp900543555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp900543555
• CAZyme ID: MGYG000002233_02027
• CAZy Family: GH91
• CAZyme Description: Inulin fructotransferase [DFA-I-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	MGYG000002233_31|CGC1	48888.3	4.802

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002233	2531817	MAG	United States	North America

• Gene Location: Start: 3748; End: 5091 Strand: +

Full Sequence      

MGNYYDVTQWPIGNAQEDIGQVINSILEDLKAHQSQTDFHEGGKPGAVIYLPPGDYHLRT
QVVIDRSYVKIMGSGHGFVSSSIRYNLPREQWPSLHEMWPGGSRVLVDLVPDPGDETSGA
AFYINREGDPRISSVEFENFCIDGLHFVEDGGRDDPENTYVNGKTGIYVASAQDSFRLNG
MGMVYLEHGVVIYHADALSIHDNFIAECGSCIELRGWGQASKVTENLLGAGYKGYSIYAQ
NFGGLLVSSNNVFPRGKSSVHLSGVARSSITGNRFHSFYPGMLEMDSNCAENLVSSNHFY
RSREPWPPMQSHDNGLDDAYGLVHIEGFHNSLIGNHFSEVIDQEYIRPQGVRPVIVRVAS
GYGNYIASNYMVGVTESAPAPAGKEDSCYSAQVGAMLSIANAQPVPLVTVQVDAQAGDNI
VLDSGREDQVVLDRTENAFRPTPAPGR

Enzyme Prediction     

EC	4.2.2.18	4.2.2.17	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH91	3	443	2.5e-185	0.9924050632911392

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21111	IFTase	0.0	3	443	3	395	inulin fructotransferase. Inulin fructotransferase (IFTase; EC 4.2.2.17 and EC 4.2.2.18), a member of the glycoside hydrolase family 91, catalyzes depolymerization of beta-2,1-fructans inulin by successively removing the terminal difructosaccharide units as cyclic anhydrides via intramolecular fructosyl transfer. As a result, IFTase produces DFA-I (alpha-D-fructofuranose-beta-D-fructofuranose 2',1:2,1'-dianhydride) and DFA-III (alpha-D-fructofuranose-beta-D-fructofuranose 2',1:2,3'-dianhydride).
pfam13229	Beta_helix	0.009	188	300	24	135	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNE51272.1	1.34e-241	3	446	5	452
AWF51207.1	1.34e-241	3	446	5	452
QXC95620.1	1.34e-241	3	446	5	452
QSW14437.1	5.43e-241	3	446	5	452
QWA90781.1	5.43e-241	3	446	5	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZKS_A	2.32e-206	3	446	5	444	Crystalstructure of DFA-IIIase from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZKU_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_B Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_C Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_D Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_E Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_F Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKW_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_B Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_C Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_D Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_E Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_F Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6]
5ZL5_A	5.42e-205	3	446	5	444	Crystalstructure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_B Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_C Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_D Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_E Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_F Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZLA_A Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_B Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_C Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_D Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_E Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_F Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6]
5ZKY_A	3.55e-197	3	446	5	419	Crystalstructure of DFA-IIIase from Arthrobacter chlorophenolicus A6 without its lid [Pseudarthrobacter chlorophenolicus A6],5ZL4_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 wihout its lid in complex with GF2 [Pseudarthrobacter chlorophenolicus A6]
2INU_A	4.78e-109	3	443	13	410	Crystalstructure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INU_B Crystal structure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INU_C Crystal structure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INV_A Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7],2INV_B Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7],2INV_C Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19870	1.02e-88	5	372	6	353	Inulin fructotransferase [DFA-I-forming] OS=Arthrobacter globiformis OX=1665 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002233_02027.