CAZyme Information: MGYG000002234_00097

Basic Information

• Species: Bariatricus sp900554415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Bariatricus; Bariatricus sp900554415
• CAZyme ID: MGYG000002234_00097
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821	MGYG000002234_1|CGC1	94978.49	6.955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002234	2915744	MAG	Peru	South America

• Gene Location: Start: 82414; End: 84879 Strand: +

Full Sequence      

MTNAFDVTACRFHTKEKNILAVTGYFRENHWENEQLCFCMNGAELSYKEQEIRLHPVQFR
KINGRLITKQMLYWITLPDNWKILGNLQIFQIQEGKAVCRKKLSGRKLENLEKYLAASVD
IVRTGRESFTIEGWYMNCEHAVLCVLDDHGKELEVKVTETRRLDVLREYPENVKEDVTGF
SAVYHGMVPQVVTVSVKDGNKENHIKVGLKKKLLKQRVRDARVMEHKAREYYKQFGLKAT
WIRATDKLMGREYSGYSEWLRRNCPSKSVLRRQRKEVFSYIPKISILVPLYKTPEEYLKK
MIDSVRNQSYENWELCLSDGSGADSPVQEILKGYLKKDKRICLKCNDEALRIAENTNMAC
SMATGDYLIFLDHDDLLSADALYECVKALNEHSDMELIYSDEDKVTMDGKEYFLPHFKPD
FNMDLLRSTNYFCHLVMVKRSLYERVGNLNPDFDGAQDYDFVLRCVEKTRPEQIYHIPKV
LYHWRACEGSTSENAKNKMYIVEAGAKAIQAHYTRMKIDAEVVPLAYGGMYRSKYHLNGQ
PKVSVIIPNKDHIEDLQNCIRSLKEKNTYDNMEYLIVENNSEKEETFAYYKELERECSKA
KVIYWKGTGFNYPDINNYGVQHATGEYLLLLNNDTEIIKEDCIEELLGYCMRKEVGIVGA
RLYYDDGTLQHGGVIVGLGGVAGHAFLGLPMGDPGYFARALLTQDLSAVTAACMMVKRSV
YEEVGGFDSAFAVAFNDVDFCLKVRQAGYLVVYHPYAELIHYESKSRGYDDTAEKINRFQ
SEIQLFQGRWKAFLEQGDPYYNPNLTLDRNDFSVNLNSRQK

Enzyme Prediction     

No EC number prediction in MGYG000002234_00097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	285	445	3.1e-22	0.9823529411764705
GT2	544	724	2.3e-19	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.10e-101	282	486	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.52e-39	545	763	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	7.37e-29	539	768	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.34e-25	295	492	10	201	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.62e-20	285	443	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT49543.1	0.0	1	815	1	810
QHB25117.1	8.78e-306	1	816	1	814
QEI32629.1	8.78e-306	1	816	1	814
QRT31219.1	2.50e-305	1	816	1	814
QUO33456.1	2.16e-298	1	816	1	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.27e-08	284	430	7	158	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.88e-142	282	812	366	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	9.20e-92	256	811	293	837	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	6.95e-17	282	500	8	229	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q57022	4.38e-12	281	475	3	192	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
O32268	9.68e-10	282	494	6	213	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002234_00097.