CAZyme Information: MGYG000002235_00392

Basic Information

• Species: Zag111 sp004558955
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp004558955
• CAZyme ID: MGYG000002235_00392
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42794.24	9.0926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002235	1989703	MAG	Peru	South America

• Gene Location: Start: 105289; End: 106413 Strand: +

Full Sequence      

MKRLFIITGEYSGDIHASNVVRELKALNCDLEIEGIGGMNLEKEGVKLFANQEKMSAVGL
SPQIIINHYKLGKALVDYLKNTYKPDLVLLIDYGAFNLTIARFLHKAGIKVFYYIPPQVW
ASRKYRINLIKKFVDKVLCIFPFEKPLYAQYGIDTHYCGHPLVAQLPAPVGKREFLREHG
FDIERPLVSVFPGSREFELKHLMPVFKDAVNRLRHRHPELQFCFSHAPNLSDEVYNKYFQ
DMDVKVIKGENQALLSASDALILASGTVALEACLYKTPMIIAYKGPQLFYWIYLLVRCIK
RVSLPNIIADKTIVPELIQKNANTINITFEIERLLYDKKEREKNIKELGEVKALLSSKNS
ALEVAKVIDMELFP

Enzyme Prediction     

No EC number prediction in MGYG000002235_00392.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	354	3.1e-106	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.33e-120	1	369	1	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	9.07e-103	1	368	1	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.61e-79	4	364	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.16e-63	6	344	10	354	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.30e-42	1	369	1	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.42e-179	1	373	1	373
AEH45383.1	9.40e-77	3	367	10	371
AKQ33376.1	5.54e-75	2	367	6	371
VEB37934.1	2.90e-73	2	372	5	379
CBJ11828.1	4.68e-72	2	373	5	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.00e-43	6	320	11	330	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.59e-43	6	320	11	330	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ZVR9	1.42e-71	3	372	6	379	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
Q5WWX7	7.94e-71	3	372	6	379	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Lens) OX=297245 GN=lpxB1 PE=3 SV=1
B6J9H1	4.98e-70	2	373	4	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
B6J161	1.97e-69	2	373	4	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	2.78e-69	2	373	4	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002235_00392.