CAZyme Information: MGYG000002236_00647

Basic Information

• Species: UBA6984 sp900550295
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA6984; UBA6984 sp900550295
• CAZyme ID: MGYG000002236_00647
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
192		20978.72	9.3782

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002236	1761697	MAG	Peru	South America

• Gene Location: Start: 35289; End: 35867 Strand: +

Full Sequence      

MVASLQMTLQRINAIERQFASLSQQTTLTVDQPKTDADFQKILDKKVEAAKAGHTKGERV
PNSEIDSLIEQYSAKNGLDKDFVKSVVRHESGFNVNATSKCGAMGLMQLMPATAQGLGVT
NAYDAEQNIAGGTKYLKGLMDRFDNNKELALAAYNAGPNAVKKYGGVPPYKETQNYVKNI
MKTYDNYKGGSN

Enzyme Prediction     

No EC number prediction in MGYG000002236_00647.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	81	188	6.4e-32	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.64e-50	81	184	2	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	9.26e-49	67	188	8	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	8.04e-44	68	185	7	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	1.88e-37	69	188	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	9.70e-35	69	176	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQX23894.1	3.36e-47	64	184	83	203
AMX00985.1	4.25e-47	61	185	88	212
ACL75193.1	3.22e-46	65	188	107	230
QXM05739.1	3.69e-46	28	192	25	187
QHZ46261.1	1.26e-45	21	184	45	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.90e-17	63	181	414	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.90e-17	63	181	418	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.91e-17	63	181	424	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.92e-17	63	181	428	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.93e-17	63	181	434	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	6.92e-45	65	184	60	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	3.96e-38	62	184	1419	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.96e-38	62	184	1419	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	4.95e-18	73	191	15	126	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P39434	6.46e-15	58	187	474	624	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002236_00647.